PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca21730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family YABBY
Protein Properties Length: 134aa    MW: 15168.8 Da    PI: 10.5835
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca21730.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY136.24e-422111378170
       YABBY  78 eeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                 ++++ +   ++++ a ++++  +     + e+p++p + rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  Dca21730.1  21 NNQAPNYSFSQTNVAASYTTPASNRGGPNVELPKPPSTTRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 113
                 22222222233333333332222245567899**999******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.3E-3923113IPR006780YABBY protein
SuperFamilySSF470951.44E-855107IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.106.9E-561105IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MTHHNHNLFS SNPHTHMGEM NNQAPNYSFS QTNVAASYTT PASNRGGPNV ELPKPPSTTR  60
PPEKRQRVPS AYNRFIKDEI QRIKAGNPDI SHREAFSAAA KNWAHFPHIH FGLMADQAVK  120
RTSNMRPHHP QDEK
Functional Description ? help Back to Top
Source Description
UniProtSeems to be associated with phloem cell differentiation. {ECO:0000269|PubMed:17676337}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021855930.13e-64axial regulator YABBY 5-like
SwissprotA2X7Q31e-39YAB4_ORYSI; Protein YABBY 4
SwissprotQ6H6681e-39YAB4_ORYSJ; Protein YABBY 4
TrEMBLA0A0K9QY627e-63A0A0K9QY62_SPIOL; Uncharacterized protein
STRINGXP_010676177.14e-60(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.14e-40YABBY family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang C,Ma Y,Li J
    The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway.
    J. Exp. Bot., 2016. 67(18): p. 5545-5556
    [PMID:27578842]