PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca21386.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 321aa    MW: 35588 Da    PI: 5.25
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca21386.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-29134186255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +rl+Wtp+LH+rFve+v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Dca21386.1 134 ARLVWTPQLHKRFVEVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 186
                 79******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.868130189IPR017930Myb domain
SuperFamilySSF466896.09E-19131190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-29131190IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23134186IPR006447Myb domain, plants
PfamPF002493.2E-8136185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGEVNGNFNG GDDSDRVHEW EAGLPNFEDI TPLSHGLIPP ELLSAFNITP EPYRTSGDVA  60
QASQQTISSI RGSNFGNVVG KEVVVVDEVM DEDDGDVDDL DGVSPEKKSR RNFSPEDADS  120
AAAAAADEKA AKRARLVWTP QLHKRFVEVV AHLGIKNAVP KTIMQLMNVE GLTRENVASH  180
LQKYRLYLKR NQGYSLENGQ SNSSQATNVQ ANHMMELLLL LKFFVIDYEP GKERQNFLSK  240
FGLGDAFREM TNSYGDASDV RSNIGLRIAY ISSGVFLSVV IYGKIYLSLI SGERLRAAGH  300
FRLESVLFLS RDCRSLYCTN F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A9e-34133189157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is a critical component of the regulatory circuit of the circadian clock. Binds to specific sites on CCA1 promoter leading to CCA1 activation. Is required for the rhythmic expression of other clock genes such as LHY, GI and APRR1/TOC1. {ECO:0000269|PubMed:21447790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021715378.13e-72transcription factor PCL1-like
RefseqXP_021715379.13e-72transcription factor PCL1-like
RefseqXP_021715380.13e-72transcription factor PCL1-like
SwissprotQ9LTH42e-57PCLL_ARATH; Transcription factor BOA
TrEMBLA0A2P2L0875e-66A0A2P2L087_RHIMU; Uncharacterized protein
STRINGXP_010685710.15e-69(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.12e-48G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]