PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca18912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 292aa    MW: 32059.3 Da    PI: 6.9535
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca18912.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-332680155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt+eLHerF++av+qLGG++kAtPktil++m+vkgLtl+h+kSHLQkYR+
  Dca18912.1 26 KPRLRWTSELHERFIDAVSQLGGPKKATPKTILRTMGVKGLTLYHLKSHLQKYRM 80
                79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9622383IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-312380IPR009057Homeodomain-like
SuperFamilySSF466891.18E-162581IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-242681IPR006447Myb domain, plants
PfamPF002494.8E-92879IPR001005SANT/Myb domain
PfamPF143796.9E-25123169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MYTTSHGTWE SVGGEEACVV LTTDPKPRLR WTSELHERFI DAVSQLGGPK KATPKTILRT  60
MGVKGLTLYH LKSHLQKYRM GKQPSKEATE NSKDASFKGD IHDTDSSTSS AKIKDQELND  120
GNQVTEALRV QMEVQRRLHE QLEVPRHLQL RIEAQGKYLH SLVEKACKAL SDQAAVSSYG  180
FEAAHEELSE LAIRISASES SGLVLPDTVK MPSSLAPVTP LHDVRNAPMV SAWISDCSVD  240
SCLTSMESPV SPLGAPSHPF AAKKRTRHVF GNGDMIPIDC SSDQVGWIMA NI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-192682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-192682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-192682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-192682157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323774.21e-121protein PHR1-LIKE 3
SwissprotQ8LAJ78e-99PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA9PEQ81e-120A9PEQ8_POPTR; Uncharacterized protein
STRINGXP_002518104.11e-119(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-101G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]