PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca18828.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 446aa    MW: 48714.1 Da    PI: 6.8263
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca18828.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32281336156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Dca18828.1 281 KSRRCWSPELHRRFLNALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 336
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.089278338IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-28278339IPR009057Homeodomain-like
SuperFamilySSF466895.38E-18279339IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-27281336IPR006447Myb domain, plants
PfamPF002491.9E-7283334IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MMDFRNNMHK CQEYVHGLEE EKKKIQVFQR ELPLCLELVT QAIEACKQQL SGTITTAAAA  60
TTTTAEFNGN NSECSEQTTS EDGPILEEFI PLKTSHFNDD DDEEDHECNK PFNNINNNEK  120
SGKKSDWLRS VQLWNQTPDP STNQLQDIQP KKVAVVEVTK NGGSGGAFHP FKKEKICSNG  180
HGNVNMIMDI DINENNNNNT NNNNNNNNNI NVNNNNNNNN TVIDDNKDNK NTKPTSVPAV  240
SACSSAEAGE NGSGSGSGSG SGSGSGSRSK KEEKSEQSQR KSRRCWSPEL HRRFLNALQQ  300
LGGSHVATPK QIRELMKVDG LTNDEVKSHL QKYRLHTRRP SSSVQNNPNP QTPQPHFVVV  360
GGIWVPPPEY ATGGNTTAVH PSSNSIYTPV ATVASPSSLP KTSTVVSSPR QEPKLSNHSR  420
CGDRGSPSDG HDTSSSTHTT TASHAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-14281334154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14281334154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14281334154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14281334154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14281334255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695844.11e-149PREDICTED: myb family transcription factor EFM
TrEMBLA0A0J8B7X91e-147A0A0J8B7X9_BETVU; Uncharacterized protein
STRINGXP_010695844.11e-148(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-43G2-like family protein