PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca17782.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 489aa    MW: 54076.2 Da    PI: 5.0839
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca17782.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.27.7e-28117170155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprl W+ eLH++Fv+av++L G+ekA Pk+il++m+v+gLt+e+v+SHLQkYRl
  Dca17782.1 117 KPRLFWSVELHQKFVDAVNSL-GIEKAFPKKILDMMNVEGLTREKVASHLQKYRL 170
                 79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011014.789142IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521727.83E-8346IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.7E-11349No hitNo description
SuperFamilySSF466891.43E-18114174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28114175IPR009057Homeodomain-like
PROSITE profilePS5129411.109114173IPR017930Myb domain
TIGRFAMsTIGR015571.6E-22117170IPR006447Myb domain, plants
PfamPF002491.1E-6122169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MTVLSSYSDT KRVMQGIRNG ACDYLVKPVR IQELQNIWQH VVRRNKSITL KRPPPSSIEL  60
QVNNEEFNQN NVHDVPCDER RKCKILEENS SRGDDMNDDD EQEDSGRDNE ESTQPKKPRL  120
FWSVELHQKF VDAVNSLGIE KAFPKKILDM MNVEGLTREK VASHLQKYRL YLRKVNDGTD  180
DASSKISAYE NGNIGPLGGG YGVFQSLAGT TTRYPGINQS LLHPAMFGRL NTVAGVSIRG  240
LPSSPMLQTV QLPNVNSTPF PLGNFTPNHN GTIFQGFPSL DENEGAFANQ PSSNNGALEG  300
TSNTQHNLLT PNMSGKTLAP PMSQMPNVQN DPLAYLCGFS SITDSKENLQ TQDYSNGNNI  360
SNLNLLGQSH MCPDHMPDCI VSSCNTSVAS TSLIPDVAPV YQNVSQNNSN VSTLPLRHLE  420
GSSSQIMQQP NDKQHMKFDD FPLDDSKMVG SSSNGGSEYL EDILGKFLKQ DSGETTRARD  480
EFDIDPFLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22113176164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687814.11e-129PREDICTED: two-component response regulator ARR12
STRINGXP_010687814.11e-128(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.12e-45response regulator 18