PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca14520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 314aa    MW: 35030.8 Da    PI: 6.6408
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca14520.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-3274127255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m++kgL+++hvkSHLQ+YR+
  Dca14520.1  74 PRLRWTPDLHLCFVHAVERLGGQERATPKLVLQMMNIKGLSIAHVKSHLQMYRS 127
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-3070128IPR009057Homeodomain-like
PROSITE profilePS5129411.74270130IPR017930Myb domain
SuperFamilySSF466891.58E-1472128IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-2374129IPR006447Myb domain, plants
PfamPF002491.3E-975126IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MIRARSGSLE GSKTSLSNDN FDEYEEEEEE IDDNNEAKIN GLSSSNSTVE ENENKIKGGS  60
SGGSVRPYNR SKMPRLRWTP DLHLCFVHAV ERLGGQERAT PKLVLQMMNI KGLSIAHVKS  120
HLQMYRSKKL DEANQAMGNQ GMFGDGRDNI YNLSQLPMLQ GYNHQRSSFN LRYGETSWRD  180
GYGTQNYAPN HNNGTSSNFG SFAERVMMFN TNSNSKANAN FNSLQENRPA IKRKTLDQLD  240
LSLTLAPKDA INPPKIISND SELSLSLQIP PPPAPPPLPP QPQSGSDQLI NQLLNDDEDG  300
RSRKHARTNL DLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-1975129357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-1975129357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-1975129357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-1975129357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021732658.11e-106two-component response regulator ARR1-like
TrEMBLA0A0J8BEJ51e-93A0A0J8BEJ5_BETVU; Uncharacterized protein
STRINGXP_010693076.12e-94(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-49G2-like family protein