PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca13546.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 86aa    MW: 9518.16 Da    PI: 11.6592
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca13546.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.8e-331467255
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Dca13546.1 14 PRMRWTSTLHSHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 67
                9****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.81E-171168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-291268IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-251467IPR006447Myb domain, plants
PfamPF002493.7E-81566IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MIGGGVLKRS IRAPRMRWTS TLHSHFVHAV QLLGGHERAT PKSVLELMNV KDLTLAHVKS  60
HLQMYRTVKS TEKASSSPGI QIGFSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-191569458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444661.13e-42PREDICTED: probable transcription factor KAN4
SwissprotQ9FJV54e-41KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A1S3BAW67e-41A0A1S3BAW6_CUCME; probable transcription factor KAN4
STRINGXP_004152789.15e-43(Cucumis sativus)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.23e-44G2-like family protein
Publications ? help Back to Top
  1. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  2. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  3. Gomez MD,Ventimilla D,Sacristan R,Perez-Amador MA
    Gibberellins Regulate Ovule Integument Development by Interfering with the Transcription Factor ATS.
    Plant Physiol., 2016. 172(4): p. 2403-2415
    [PMID:27794102]