PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca13480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 693aa    MW: 77227.1 Da    PI: 7.4606
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca13480.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32453507155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+rlrWt+eLH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Dca13480.1 453 KQRLRWTEELHNRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 507
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF012662.1E-412316IPR006076FAD dependent oxidoreductase
SuperFamilySSF519051.55E-183162IPR023753FAD/NAD(P)-binding domain
Gene3DG3DSA:3.50.50.609.6E-860161IPR023753FAD/NAD(P)-binding domain
Gene3DG3DSA:3.50.50.609.6E-8278323IPR023753FAD/NAD(P)-binding domain
SuperFamilySSF519051.55E-18278342IPR023753FAD/NAD(P)-binding domain
PROSITE profilePS5129413.437450510IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-31451508IPR009057Homeodomain-like
SuperFamilySSF466891.79E-17452507IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-25453508IPR006447Myb domain, plants
PfamPF002493.6E-8455506IPR001005SANT/Myb domain
PfamPF143791.5E-23540585IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0003973Molecular Function(S)-2-hydroxy-acid oxidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MYKYCSERDV PHKQIGKLIV ATRESEIPKL NEILARGIEN GVDGLRLMEA SEAMGMEPEL  60
HCVKAVFSPL TGIVDCHTLM LSLLGDAENN GATFAYNTTV LGGELLGNQI SLAVTTSQNL  120
ETWNEFDVLP TELTLLPKVV INSAGLAAIP LAKRLIGLDS SVIPKPYYAR GHYFSLSKTK  180
TPPFTRLIYP LPEDGGIGVH VTLDLDGQIK FGPDVEWLDL VPDVASFLNG FEYSVSPHRA  240
EIFYPEIRKY YPNLKEQSLE PGYSGIRPKI SGPQTTPCDF VIQFEDIHGV PGLVNLFGIE  300
SPGLTSSLAI ADHVASRVIH STLLVWLGFR RPVKPLRAEL AWFSCRFRRK SWKSRWANVC  360
LVAAIYVLWE ERNNRIFVDK ERSLEVLVRR IQFYFSLCKV PSLFCSDMYH NKKFSTVSLV  420
PHKTQASEPL ANYGSLGSPT AKNSPPPPGG SGKQRLRWTE ELHNRFVDAI TQLGGPDRAT  480
PKGVLRVMGV PGLTIYHVKS HLQKYRLAKY LPESPSDGSK DEKKGSGDQA SVDPSSQGLQ  540
IDEALRMQME VQKRLHEQLE VQRQLQMRIE AQGKYLQKII EEQQKLGSAL KVSDALSSKE  600
QLDVKSKSSE SQPSTENSPV PTSPQRKKHK SDIVPPSEND QKQAFVDQWD QHLYEISASD  660
FGMNLETGFR KQEDSSVVQH GISPTPNLGG GQE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3dme_A2e-87131874367conserved exported protein
3dme_B2e-87131874367conserved exported protein
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-68G2-like family protein