PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca12836.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 533aa    MW: 58102.1 Da    PI: 7.3622
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca12836.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.31.5e-32306360155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 ++rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Dca12836.1 306 RQRLRWTEDLHNRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 360
                 58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd061743.31E-111253IPR020846Major facilitator superfamily domain
SuperFamilySSF1034731.44E-142255IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.201.4E-779253No hitNo description
PROSITE profilePS5129411.722303363IPR017930Myb domain
SuperFamilySSF466897.7E-17306360IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-31306361IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-25307361IPR006447Myb domain, plants
PfamPF002498.8E-8308359IPR001005SANT/Myb domain
PfamPF143793.0E-22394439IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MFGLSKTYWM ALTSRFLLGA LCGVLGPIRI SSAWGIGLVV GPALGGYLSQ ETLHSHDAIE  60
DNANFVSKDV EKSKGIEDES SNSWVSLMKN WPLMSVVIMF SVFQMHDMAF NEIFSLWAVS  120
PRSLGGLGFL TSDVGNALAV TGISVLLCQS FLYPVVERAL GPMTIARGAT VLSIILLTSF  180
PFIGNLTGTT LKVVIDLASA IQNVLAVTVL TGMFLLQNRA VCQAQRGTAN GISLCIVSFA  240
NAIGPAAAGS ILSWAQSRQK SSFLPDMYHD TNFSTVSLAP HNTQASEQAG NHGAAGSPTP  300
PGAGGRQRLR WTEDLHNRFV DAITQLGGPD RATPKGVLRV MGVPGLTIYH VKSHLQKYRL  360
AKYLPESPSD GSKDEKKGSG DGLADTDPSS QGLEISDALR MQMEVQKRLQ EQLEVQRQLQ  420
MRIEAQGKYL QKIIEEQQKL DSSLRASDAR PSLKRDDPTN KPSESQSGAE RSPANSSPTR  480
KKQKLDDSTK GIIDPLSLVD PILDPPETDH RQTFENQWDE HLYRNKEVEN RRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-23305363159Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-48G2-like family protein