PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca12454.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LFY
Protein Properties Length: 474aa    MW: 52294.8 Da    PI: 6.5649
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca12454.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY6112.3e-1868545932385
     FLO_LFY  32 vseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrr 130
                 +s+++++++a +++++  +le+lf+ yG+ry+t++kiae+GftvstLvdmkdeel+d+m+sls++fr+dllvGeryGikaa+raerrrle+ ++++++r
  Dca12454.1  85 ASNNNNNNNAPNTSNNSGGLEDLFQPYGIRYYTATKIAEMGFTVSTLVDMKDEELEDMMNSLSHLFRWDLLVGERYGIKAAIRAERRRLEDLDESRRQR 183
                 334444555566666688*************************************************************************77766655 PP

     FLO_LFY 131 k..ll........sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaee.kkseeekkkaskkkqkrkkkkelkse.ededeeeeedede 217
                 +   l        ++  ++ ldalsqeglsee+  +eke +gsgg+g g++++vaa++ + +++++kk++  +q  +k+++++ e  ++++e eede +
  Dca12454.1 184 HhhNLmsysatppTDSGHHPLDALSQEGLSEEAGMQEKEVVGSGGGGGGSWDMVAAAAlQYQQQQRKKQRPPQQPPRKTSNMVVEdMEDEDEVEEDELD 282
                 53422467666633444559************************************9944444455555554555444444443323333333333334 PP

     FLO_LFY 218 eg.........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvh 307
                 +g         +g + +erqrehPfivtepgevargkknGLDYLf+LyeqCr+fLlqvq+iakerGekcPtkvtnqvfr+akkaga+yinkPkmrhYvh
  Dca12454.1 283 HGivggggcggGGGGCSERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLLQVQNIAKERGEKCPTKVTNQVFRFAKKAGATYINKPKMRHYVH 381
                 43677777654444445********************************************************************************** PP

     FLO_LFY 308 CYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                 CYalhcLde++snalrrafkergenvGawrqacykplvaiaarqgwdida+fn+hprLsiWYvPtkLrqLCh+ers++
  Dca12454.1 382 CYALHCLDEDTSNALRRAFKERGENVGAWRQACYKPLVAIAARQGWDIDAIFNSHPRLSIWYVPTKLRQLCHAERSSS 459
                 ***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.3E-17992459IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MDQDPFTASL FKWDYPRGSS MGASSAPTQP LPPGQTTIPA YLARGLLGMR DPVGYPGMGM  60
GMGMGMGMGM GMQGMMSMGM SQSGASNNNN NNNAPNTSNN SGGLEDLFQP YGIRYYTATK  120
IAEMGFTVST LVDMKDEELE DMMNSLSHLF RWDLLVGERY GIKAAIRAER RRLEDLDESR  180
RQRHHHNLMS YSATPPTDSG HHPLDALSQE GLSEEAGMQE KEVVGSGGGG GGSWDMVAAA  240
ALQYQQQQRK KQRPPQQPPR KTSNMVVEDM EDEDEVEEDE LDHGIVGGGG CGGGGGGCSE  300
RQREHPFIVT EPGEVARGKK NGLDYLFHLY EQCRDFLLQV QNIAKERGEK CPTKVTNQVF  360
RFAKKAGATY INKPKMRHYV HCYALHCLDE DTSNALRRAF KERGENVGAW RQACYKPLVA  420
IAARQGWDID AIFNSHPRLS IWYVPTKLRQ LCHAERSSSA GSSISAAATD HLPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1072994583162PROTEIN LEAFY
2vy2_A1e-1072994583162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021771140.10.0LOW QUALITY PROTEIN: floricaula/leafy homolog
SwissprotO040641e-174FLLH_POPTR; Floricaula/leafy homolog
TrEMBLQ8RW100.0Q8RW10_9CARY; Putative LFY transcription factor
STRINGXP_010667025.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-106floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]