PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_032067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 226aa    MW: 25940.8 Da    PI: 10.5629
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_032067genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like68.61e-21113165255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +r++Wt + H++Fv+av+ + G +k  Pk+ilelm+v+ Lt+e+v+SHLQkY l
  DCAR_032067 113 TRVVWTVDPHQKFVKAVNYM-GFDKVGPKKILELMNVPWLTRENVASHLQKYQL 165
                  79******************.9******************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF536592.67E-141872No hitNo description
Gene3DG3DSA:3.40.718.104.1E-162068IPR024084Isopropylmalate dehydrogenase-like domain
PfamPF001809.8E-82072IPR024084Isopropylmalate dehydrogenase-like domain
SuperFamilySSF466894.3E-17110169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-25111170IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-19113165IPR006447Myb domain, plants
PfamPF002493.9E-6114163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0016616Molecular Functionoxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MRSVRKNSKK IRGNVYEILK NSERIAKYAF EYAYLNNRRM VTAVHKANIK KLADGLFLES  60
CREVASKYPA VEEVFFSRSQ LIHCDLNSGR KRKDFDNKHN DKNFGHPSAG KRTRVVWTVD  120
PHQKFVKAVN YMGFDKVGPK KILELMNVPW LTRENVASHL QKYQLYLSRL QKENDLKPSH  180
GGIKQSTDAT SRDQAGNLGF KNSINITHNN AANTNFLIYS KMCML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-17108170163ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017224636.12e-81PREDICTED: two-component response regulator ORR26
SwissprotQ5N6V86e-35ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A175YBM31e-168A0A175YBM3_DAUCS; Uncharacterized protein
STRINGXP_004310018.17e-52(Fragaria vesca)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.12e-31response regulator 11
Publications ? help Back to Top
  1. Du L, et al.
    The two-component signal system in rice (Oryza sativa L.): a genome-wide study of cytokinin signal perception and transduction.
    Genomics, 2007. 89(6): p. 697-707
    [PMID:17408920]