PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_031212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 715aa    MW: 77479.7 Da    PI: 6.1485
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_031212genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.71e-1273507102374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   +lLl+cAeavs++++e+a+++L ++s+l++p g++ qR+ ayf eA++arl++s+ ++y++lp++  +  + ++ ++a+++f+ +sP++kfsh+taN
  DCAR_031212 350 LKLLLQCAEAVSADNFEEASTMLLEISQLSTPFGTSAQRVGAYFSEAMSARLVSSCLGIYASLPTTMVP-PHGQKMASAFQVFNGISPFVKFSHFTAN 446
                  689************************************************************999887.5799999********************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  qaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpps+R+Tg+g       e+le+tg+rL++fA++lg+pfef++ va+++ +l++e+++v+
  DCAR_031212 447 QAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPSVRLTGFGT----CMEALEATGKRLSDFADKLGLPFEFSP-VADKVGNLDPERINVS 539
                  **************************************************....***************************.7*************** PP

         GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                  ++Ea+aV++    h+l+d ++s ++    +L+l+k+l Pkvv+vveq+++h++ sFl rf+ea++y+salfdsl a++++eseer++vE++ll+rei+
  DCAR_031212 540 KKEAVAVHWLQ--HSLYDVTGSDAN----TLSLLKRLAPKVVTVVEQDLSHTADSFLGRFVEAIHYFSALFDSLGASYGEESEERHVVEQQLLSREIK 631
                  **********9..999999999999....********************************************************************* PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  nv+a  g +r    e   +Wre+l+++GFk ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaW+
  DCAR_031212 632 NVLAVGGPSRSGGGELRFNWREKLQQSGFKGISLAGNAAAQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWK 710
                  ******************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.82323690IPR005202Transcription factor GRAS
PfamPF035143.5E-125350710IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MVRKRLASEM EVQPGDECRN RFSGRRATNL NPQTIGLHAA GVVVNNISNG NYNNTGSSNH  60
PQIPNYSTTT VMFSSSAINT STCIMDGSSH QSASPSVCVF SGLPLFPPVL QQQQQPLLSS  120
PPIVPLITPT TTTSPIGTQV GTDSNSDSSA AMAWIDGIIK DLLHSSSPVS IPQLLQNVKE  180
IIHPCNPSLA SLLESRLRTL TTTTTMDPDT MRKETTSPAI RNSQYPHYHH NLQITSKVTP  240
QLHPSSAAPP TGLVDVDNFV AVAASASASV NHYNNWELPQ TATSSNEAMP TAHIPVMLSN  300
QIKMHEDSML PPPPAAADAS QVMDDAAVFR EKRKEDIRQL KRDEEGLYLL KLLLQCAEAV  360
SADNFEEAST MLLEISQLST PFGTSAQRVG AYFSEAMSAR LVSSCLGIYA SLPTTMVPPH  420
GQKMASAFQV FNGISPFVKF SHFTANQAIQ EAFEREDRVH IIDLDIMQGL QWPGLFHILA  480
SRPGGPPSVR LTGFGTCMEA LEATGKRLSD FADKLGLPFE FSPVADKVGN LDPERINVSK  540
KEAVAVHWLQ HSLYDVTGSD ANTLSLLKRL APKVVTVVEQ DLSHTADSFL GRFVEAIHYF  600
SALFDSLGAS YGEESEERHV VEQQLLSREI KNVLAVGGPS RSGGGELRFN WREKLQQSGF  660
KGISLAGNAA AQATLLLGMF PSDGYTLVED NGTLKLGWKD LCLLTASAWK PLYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.03337113380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division (By similarity). Required for differentiation of endodermis and graviresponses. {ECO:0000250, ECO:0000269|PubMed:16339910}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017224402.10.0PREDICTED: protein SCARECROW-like
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLA0A175YJK40.0A0A175YJK4_DAUCS; Uncharacterized protein
STRINGVIT_08s0056g00050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82582430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein