PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_031178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 526aa    MW: 58975 Da    PI: 6.3794
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_031178genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3603.5e-1101525211374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykalppsetseknsseelaalklfsevsPilkfshlt 97 
                  lv+lL++cAeav+ +d+  a++lL++l+ +a   g+++qR+a++f+++L+ rla  ++ +++  + p  ++   s e+  al+l ++++P ++f+h++
  DCAR_031178 152 LVQLLIACAEAVACRDKLHASTLLSELRANALVFGTSFQRVASCFVQGLSDRLALVQPlGTVGVVIPHLETMAISLEKEEALSLVYNICPHIQFGHFV 249
                  689***************************************************94441444444444444445999999****************** PP

         GRAS  98 aNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                  aN +Ilea+ege+ +H++D+++s    +G QW +L+ +La+R+++p +l iTgvg+     +e l e+g+ L+++A +lg++fef+v v+ +le+l++
  DCAR_031178 250 ANAMILEAFEGESSIHVVDLGMSlglrHGHQWRSLMYSLANRAGKPRRLHITGVGN----CAEHLLEIGDDLEQYAFNLGLNFEFSV-VECNLENLQP 342
                  *******************98753333788**************************....**************************9.6889****** PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                  +++++ +gE+l++n++l+lh +++es    +   +vL+ + +lsPk +++veq+++hn++ Fl rf+eal+yysa+fdsl++ lpr +  r+k+E+++
  DCAR_031178 343 RAFKLIEGETLVINSILHLHCVVKESRGALN---AVLQKLHQLSPKYLILVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDTMLPRYDTRRAKIEQFY 437
                  ***********************88887777...9*************************************************************** PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++ei+n+v+ceg +r+erhe++ +Wr+r+++aGF+++p+++   +q k  l+k+k sdgy+  ee+g+l+lgWk++p++++S+W+
  DCAR_031178 438 FAEEIKNIVSCEGPARVERHERADQWRRRMSRAGFQSAPIKK--ITQTKQWLEKMKvSDGYTTVEEKGCLILGWKSKPIIAASCWK 521
                  ****************************************86..689999******9****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.937126502IPR005202Transcription factor GRAS
PfamPF035141.2E-107152521IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MAPGFYLQSK FCDDDEKNNH ARLLNYKLSG TKRYSAPYGY KFEESLSDCF TPFVDETQNH  60
KRLKETSCTD EFVSNEESIY SSSANTSGFY SGNSSGSTES LNSVSKPHFR DHIWAYTQRY  120
LAAETMEEAA AALVAGDEDE VKEEGSADGM RLVQLLIACA EAVACRDKLH ASTLLSELRA  180
NALVFGTSFQ RVASCFVQGL SDRLALVQPL GTVGVVIPHL ETMAISLEKE EALSLVYNIC  240
PHIQFGHFVA NAMILEAFEG ESSIHVVDLG MSLGLRHGHQ WRSLMYSLAN RAGKPRRLHI  300
TGVGNCAEHL LEIGDDLEQY AFNLGLNFEF SVVECNLENL QPRAFKLIEG ETLVINSILH  360
LHCVVKESRG ALNAVLQKLH QLSPKYLILV EQDSSHNGPF FLGRFMEALH YYSAIFDSLD  420
TMLPRYDTRR AKIEQFYFAE EIKNIVSCEG PARVERHERA DQWRRRMSRA GFQSAPIKKI  480
TQTKQWLEKM KVSDGYTTVE EKGCLILGWK SKPIIAASCW KCSSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-621365241381Protein SCARECROW
5b3h_D1e-621365241381Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226289.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_017226290.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_017226291.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A175YJ730.0A0A175YJ73_DAUCS; Uncharacterized protein
STRINGXP_006484335.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81672130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.13e-75RGA-like protein 3