PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_031015
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 286aa    MW: 32255.4 Da    PI: 7.5995
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_031015genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.4e-292173153
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                 kprl+W+peLH+rFv+av+qLGG++kAtPk+++++m ++gLtl+h+kSHLQ +
  DCAR_031015 21 KPRLKWNPELHQRFVHAVAQLGGADKATPKALMRVMRIQGLTLYHLKSHLQAF 73
                 79*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-251973IPR009057Homeodomain-like
SuperFamilySSF466891.16E-122076IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-192174IPR006447Myb domain, plants
PfamPF143798.6E-116998IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MPLQNMQQDQ DMNLVLSSDA KPRLKWNPEL HQRFVHAVAQ LGGADKATPK ALMRVMRIQG  60
LTLYHLKSHL QAFVQRHLQL RIEAQGKYLQ SVLKKAQDTL SGCNPSSAEV ELAKTELSQL  120
VSMVDNGCPS SSLSMLTETH GSFVKDNEIK PLRGTRCSLE SSLTSSESSG RKEEKRQKHE  180
TDDITNNSSE NFVVLSLMEM HSREKIGSVE KGDARKRSES KIFEVDCIEQ PLWKRSRVDK  240
SPEQLRKFDF SGTFDLNSHC SNYLDSSSKE IDLNSKEVNQ FNDNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-182073154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017224429.10.0PREDICTED: uncharacterized protein LOC108200698
TrEMBLA0A175YIC30.0A0A175YIC3_DAUCS; Uncharacterized protein
STRINGVIT_01s0026g02550.t013e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60361932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.12e-37G2-like family protein