PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 651aa    MW: 75033.9 Da    PI: 4.5281
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030941genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK40.74.6e-13487528647
       RWP-RK   6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhR 47 
                  +le++sk+F  pikdAA + g+++++ Kr+CR  GI+ W +R
  DCAR_030941 487 TLENISKHFGRPIKDAAESFGLSVSTFKRRCRDVGIEWWESR 528
                  799************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.332469553IPR003035RWP-RK domain
PfamPF020422.3E-12487528IPR003035RWP-RK domain
SuperFamilySSF542771.51E-16561649No hitNo description
SMARTSM006664.2E-11564644IPR000270PB1 domain
PROSITE profilePS5174514.587564636IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.3E-13566639No hitNo description
PfamPF005648.3E-13567639IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MGEEIEIRRD VELVNSQGLR HSLVLFWKAS WKEDHYELTI DANRSRMIGC DEEDTTTLLP  60
YQTRFAKSVI SLYDGEEEYP KGVIERVYEN GRPEISPDIK YYSEEEYPHR EFALSCGIRA  120
SFCFPLNFEH GVMEIVSTRN QDVGTLETFC KSLEHLSGFR YNFRDHEDCR NSVLEVVLEA  180
VCQRFDLPLT QYWYDDDDDY NLLRQFGDGN SEVLASWFQF KDVYLHMRFH CLLGYSNESA  240
RAFFCNNISA LSITDYPLAH YARNCGSIAC FTINLFSLLE KEEIKEEEEE GEEKEIEGEE  300
KEIEEKEIEE EIEEEIEAYA LQFFLPSQEM DNEYPQNLLN PIWTIVKESL ANFKLDARER  360
ENLEKVLSVK VINSSSTQTE PASFELGQPQ SSLPHCDGSE LTPTLKMFEK GPAQNSNSNS  420
YEEAAVVETS ILNEASQPRR SEEYFKTKGK TMAPERVDTH VEVSPDEDVE PVTPASKRLK  480
KSKIPCTLEN ISKHFGRPIK DAAESFGLSV STFKRRCRDV GIEWWESRTN HKTDGKSGVK  540
NCSLDTSSLP NRRVVIHSSQ DLNMMSVKIT HEANTIRFEL PSSFEELENI VIKKLHLDRK  600
SFSLKYQDDE DDWVDMTCDE DVRECVKVWG SFKKPTIKMK LGPPINSYPG *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226976.10.0PREDICTED: protein NLP3-like isoform X3
TrEMBLA0A175YKJ80.0A0A175YKJ8_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.12e-22Nin-like family protein