PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030939
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 205aa    MW: 23147.2 Da    PI: 5.2071
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030939genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK322.3e-104485647
       RWP-RK  6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhR 47
                 ++e+++k+F  p+kdA k+ g++++++Kr+CR   I+ W + 
  DCAR_030939 44 TVENVNKHFGRPLKDATKSFGLSQSIVKRRCRDVDIECWESG 85
                 6899*********************************99665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.46726110IPR003035RWP-RK domain
PfamPF020421.2E-84482IPR003035RWP-RK domain
SuperFamilySSF542771.64E-19120200No hitNo description
PROSITE profilePS5174521.745121203IPR000270PB1 domain
SMARTSM006662.4E-18121203IPR000270PB1 domain
PfamPF005643.1E-18122199IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-19122199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MGAELCYFGG FIVDNLVEVS SDDEDVEPVT PESEQLKKSK IPCTVENVNK HFGRPLKDAT  60
KSFGLSQSIV KRRCRDVDIE CWESGKSQKI DGKSEAKEFS LATSSLPNRR VVTDISHDIN  120
MMTVKVTYNA RTIRFELPSS SGLDELENSV IKRLHLDRKS FSIKYQDDED DWIDITCDED  180
VQECMKVSRS LKKPTIKMKL GPAY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017225467.11e-121PREDICTED: protein NLP6-like
TrEMBLA0A175YJE01e-148A0A175YJE0_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.18e-09NIN like protein 7