PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030937
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 619aa    MW: 70472.3 Da    PI: 5.3571
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030937genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK40.36.1e-13458500648
       RWP-RK   6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                  ++e++sk+F  pikdAA + g+++++ Kr+CR  GI+ W +R 
  DCAR_030937 458 TVENISKHFGRPIKDAAESFGLSVSTFKRRCRDVGIEWWESRT 500
                  7899***********************************9995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.673440524IPR003035RWP-RK domain
PfamPF020422.9E-12458500IPR003035RWP-RK domain
SuperFamilySSF542771.6E-17532614No hitNo description
SMARTSM006668.0E-16535617IPR000270PB1 domain
PROSITE profilePS5174518.398535617IPR000270PB1 domain
PfamPF005641.4E-15536612IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.0E-18536612No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MGEEIEIHRD VELVKSPGLQ HSLVLFWRVS WKDDHVELTI DANRSGMIGC DEEDETTLLP  60
YQTRFAKSVI SLDGGDMPKG VIERVHKKWS SEMSPDIKYY SEEEYPHRDF ALSCGIRASF  120
CFPFLFSLSI LEIVSTRNQD VGTLETFCKS LEYLSALRYN FRDHELLQDC RNSVLEAVLE  180
AVRQRFDLPL TQYWYNDDYN YNLLHQFGDG NSKVLASWFQ FKDVCLHMCF RCLLGVSNES  240
ARAFFCNNIS ALSIINYPLA HYARNCGPIA CFTIYLFILV EGKNYGSEYV LEFFLPSQEV  300
DNDYPQNLLN SIWTTVKDSV SNCKLAARER EKLEQVLSVK VINSSSTQTE PASFELGQPQ  360
SSLLHYDGSE LTPTLKMFDK GRDQNSNSNS YEEAAAGETS ILNEASQPRR SEEYFKTKGK  420
TMAAERVDNL VEVSSDDEDV EPVTPASKRL KKSKIPCTVE NISKHFGRPI KDAAESFGLS  480
VSTFKRRCRD VGIEWWESRT SQKTDGKSGA KNCSLDTSSL QNRHVVTHSS RVFNMMTVKV  540
TYDAGTIRFE LPSSSGIAEL ENSVIERLHL NRKSFSLKYQ DDEDDWINIT CDKDVQECMK  600
VSRSFNKPTI KMKLGPAY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017227208.10.0PREDICTED: protein NLP6-like isoform X1
TrEMBLA0A175YJQ50.0A0A175YJQ5_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.14e-28Nin-like family protein