PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 198aa    MW: 22442.4 Da    PI: 6.2862
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030936genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK38.13e-123779648
       RWP-RK  6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48
                 ++e++sk+F  pikdAA + g+++++ Kr+CR   I+ W +R 
  DCAR_030936 37 TIENISKHFGRPIKDAADSFGLSVSTFKRRCRDVDIEWWESRT 79
                 6899***********************************9995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.55819103IPR003035RWP-RK domain
PfamPF020426.1E-123779IPR003035RWP-RK domain
SuperFamilySSF542771.09E-16111193No hitNo description
Gene3DG3DSA:3.10.20.2404.3E-16113191No hitNo description
SMARTSM006668.9E-13114194IPR000270PB1 domain
PROSITE profilePS5174520.763114196IPR000270PB1 domain
PfamPF005644.0E-15115191IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MAAERVDNPL EVSPDDEDVE PVTPASKRLK KSKIPCTIEN ISKHFGRPIK DAADSFGLSV  60
STFKRRCRDV DIEWWESRTS QKTDGKSGAK HLSSDTFSLP NRRVVTHSSQ DFNMMTIKVT  120
YDARIIKFKL STSSGLEELE NSVIKRLNLD RKSFCLKYQD DADDWIDITC DEDVLECMEV  180
SRSLKKSIIE MKLGPAY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226029.11e-142PREDICTED: protein NLP7-like
TrEMBLA0A175YJ231e-142A0A175YJ23_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.11e-09NIN like protein 7