PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 620aa    MW: 70498.5 Da    PI: 5.1071
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030934genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK33.11.1e-10459497644
       RWP-RK   6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44 
                  ++e+++k+F  p+kdAAk+ g++++++KriCR   I+ W
  DCAR_030934 459 TVENVNKHFGRPLKDAAKSFGLSQSTVKRICRDVHIECW 497
                  6899********************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575131No hitNo description
Gene3DG3DSA:3.30.450.401.1E-473141IPR029016GAF domain-like
PROSITE profilePS5151910.057441525IPR003035RWP-RK domain
PfamPF020424.8E-10459497IPR003035RWP-RK domain
SuperFamilySSF542772.7E-18535615No hitNo description
SMARTSM006661.9E-18536618IPR000270PB1 domain
PROSITE profilePS5174521.454536618IPR000270PB1 domain
PfamPF005649.1E-18537614IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.4E-19537614No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGEEREINRD VELVDSRGLR HSLLLFWALS CKDEHSELTV DASISRMIGC DEEDERTLLR  60
YRTRFASSAI IVEPICSTEG VIERVFENRR AEMSPDISFY SKDEYPHRDF ALTCGIRAFF  120
CFPLCSPGRV GVMEIVSTRN QDVGILESFC TSFKDWRSLD FSFRDSDLQK YENPVLGRVL  180
EEVCQTFHLP LTQYWTCKGG FYYSLNQFSG RDFENLAPWC QFKDACLCKG FNRLLGVSNR  240
SAGAFFCSNI SALSITKYHL AHYAKNLGSI ACFTIYLLVL EEEKEYGREY ALEFFLPSQE  300
MDNDYPQTLL NCIWTKVRES LPNCKLAARE REKPGQVLLV KVINSSTHSQ PKSFEVGHPQ  360
SSLPHNEGSE FTHTLELFEK GPNQISNSKS YEEAAVGETS IRILNEASQP RGSEEYFNTN  420
GKKVTAERDN LVEVSSDDED VEPVTPESEQ LKKSKIPCTV ENVNKHFGRP LKDAAKSFGL  480
SQSTVKRICR DVHIECWESG KSQKTDGKSE AKDFSLATSS LPNRCVATDI SQDINMMTVK  540
VTYDARTIRF ELPSSSGLEE LENSVIKRLQ LDRKSFSIKY QDDEDDWIDI TCDEDVQECM  600
KVSRSLKKPT IKMKLGPAY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017225467.10.0PREDICTED: protein NLP6-like
TrEMBLA0A175YIL40.0A0A175YIL4_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.13e-25Nin-like family protein