PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030932
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 700aa    MW: 79642.7 Da    PI: 4.617
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030932genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK39.79.3e-13518560244
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44 
                  +k+i++e +s+ F  p++dAAk+ gv+ ++LKr+CR + I+ W
  DCAR_030932 518 SKDITFEGISELFGRPLEDAAKSFGVSRSTLKRKCRGLDINDW 560
                  589*************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.536506588IPR003035RWP-RK domain
PfamPF020423.4E-10521560IPR003035RWP-RK domain
SuperFamilySSF542777.29E-15610697No hitNo description
Gene3DG3DSA:3.10.20.2406.4E-15611691No hitNo description
SMARTSM006661.5E-15611693IPR000270PB1 domain
PROSITE profilePS5174519.053611693IPR000270PB1 domain
PfamPF005644.2E-14612692IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MAANSAYCTQ IWSRQKLDNV LIQIWEASRE KHQEGREYWE LKAKNEPFYV LSSDDEGFSS  60
YRIHSLASTV TIKEDGEDDD EETSVIAHVF MSNRPEMSPK IEFYSVNEYS HKDFALTCGI  120
RASLCLPLFK TVNFSGRPDG VMELVSTCDQ DLEKVKLSTH LSYFLKKLGM YSLGDNIYRF  180
IRTNTRKHAM LEMDHLLEVI CQTFRLPLAQ YWVIKDANLG GLEVMYQSSH RDFENIIPWC  240
QFKDACLRMG SHVGEGPVGK TYLSQKSLFC RDITELTITN HPLAHYAQNC GSIACFTICL  300
WSLSPQYREC VLEFFLPSQE MDSYYPQTLL NSLLTTMKEN LLFDMVASEG QLGEVLLVEV  360
INSSGYEPET FKIDHEDYVF QQGTGSSQLL FEDGTVQDEH VRDIEKSNDV TVSYLDAVVG  420
DMTIATPDIV EIDNSALEIM LEDAIKQKEH TVVPERDDLV EQSPEDSGYA MTPGTDQPSR  480
LEDLLQKQNE GIMVGLEEDD TTVQFKEDTS EREKQLGSKD ITFEGISELF GRPLEDAAKS  540
FGVSRSTLKR KCRGLDINDW RRGKQSIKGN MSSDLRRRLN DDEQAGKNFH SGLPSGEKAP  600
AVDHISQTLN EVTVRAMYNG VTIRFDLSDS SGIAELENNV IERLHLERES FSIKYRDDED  660
IWILIACDKD VRKCIEISRS LKRTSITLLV DPPINHRKQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017224724.10.0PREDICTED: protein NLP7-like
TrEMBLA0A175YIP20.0A0A175YIP2_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.14e-39NIN like protein 7