PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 705aa    MW: 80773.3 Da    PI: 5.0444
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030930genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK39.41.2e-12519561244
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44 
                  ek+ s e ls++   p+ d+Ak  g++ ++ Kr+CR +GIkRW
  DCAR_030930 519 EKKFSYESLSQHLGRPLDDVAKRFGISRSTFKRKCRDLGIKRW 561
                  79999************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.81504589IPR003035RWP-RK domain
PfamPF020421.3E-10523561IPR003035RWP-RK domain
SuperFamilySSF542772.8E-17613701No hitNo description
PROSITE profilePS5174517.697617698IPR000270PB1 domain
SMARTSM006663.1E-18617698IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-17619694No hitNo description
PfamPF005641.8E-13623697IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MIINFGHDEV TANDAATRNI LIQFWEASTE AIEGGRRYCE LTIPENSFEI LPYEVGGLSL  60
YRMHSISCTH RIQLDDEEDD YIIQSKQQEG VISRVFRYKR PEMTPHISFY SLHEYPHREF  120
ALSCGIQPSL CFPLFKTADC SGHPRGVVEL VSTCEQDLEN FKQYFESCFF VQDLNPALWQ  180
MDHVLTLVCQ KFPLRLAQFW VLTNPNSGAL SVMSQKSNLD SEELAPLCRF KDACLQTHLN  240
IGEGLVGKTC LFRKSFSCRN ITEFNITNYP LAHYARSCVS IACFTIFLRS FFPPFEECVL  300
EFFLPSQELS NYYPQTMSNT LLTTVKEHLP YYTFDLGEEL GEVPTLEVIN SSSTREIFKQ  360
THKNAVAVIN LDELEESPVK RIEPQSLTPK PNRSKEIIDE ANTMEINHFS LEITLEEAIR  420
NREYTVAARR VDELLEDVGH DKTTAAGSSS QTRISLPHQE VEVEKVTVDT SVQKLILSED  480
FSRIKNKGII VGAENVDRPI QFVSKTSLQD ELETEKQAEK KFSYESLSQH LGRPLDDVAK  540
RFGISRSTFK RKCRDLGIKR WQYGRRSTDD NISSKLRERL NAKEPSRRNF TCSGISSMQD  600
KCLNKVATAD KRQDPKKMIV EATYYDATIR FELPGFTIAE LEDDINERLH LERESFVMKY  660
QDDEGDWISI ACDEDLQECV EISKSSNNTT IKMSLDPRVN PQAQ*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226060.10.0PREDICTED: protein NLP7-like
TrEMBLA0A175YJM90.0A0A175YJM9_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.14e-42Nin-like family protein