PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 672aa    MW: 76541.5 Da    PI: 5.213
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030927genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK48.22.1e-15490533245
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWP 45 
                  +++++le++sk+F  p++dAAk+ gv+ ++ KriCR +GIkRW 
  DCAR_030927 490 KEDMNLENVSKHFGRPLNDAAKSFGVSRSTFKRICRGLGIKRWQ 533
                  57899**************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.406.6E-670142IPR029016GAF domain-like
PROSITE profilePS5151911.729475561IPR003035RWP-RK domain
PfamPF020423.2E-14493532IPR003035RWP-RK domain
SuperFamilySSF542773.08E-18581665No hitNo description
SMARTSM006666.2E-22583665IPR000270PB1 domain
PROSITE profilePS5174521.681583665IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.8E-17584660No hitNo description
PfamPF005643.8E-17584664IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MVIGFIIRDR DKECSNYARL RKPEYVSKSL IQMWVLSYKT NEEGEDYCEL STQNEPFYIV  60
SDDDDGGLAS YRMHSVAHTI MPDEVNEVEG QKQEGVISRV FKNQRPEMSP DISCYSLQEY  120
PHRDFALSCG IRSSLCVPIY QDIFSYESPG GVLEFVSTST DQLKSFRNYC RYYEAFVFRG  180
TKMNLMIDQL YCDPRRHYLR RNVEMDHLLT VVCQKYPLPL AQYWEVGDVN VRDLGVVNQE  240
GNIDFPNVTP WLQFKNACKN IGLYIDEGLV GKSYLSHKSF LCRDIKELSI TNYPLAHYAP  300
NCRPIPCFTI CLCSFKPWYR EYVLELFLPS QEMDSYDPRT LLNSLMETMK EHLPDYMVAS  360
GEQLGQVLSV EVIKSSTHDK PEYLKIGEPQ SSLPPQEGLN NEGDASHQFP FVLPSLFKDG  420
AVQDGNVMNI EESNSTINSY EEIASGETST SRPNIVPETI HADESVQESP LENIAYALTN  480
EDVNYALNNK EDMNLENVSK HFGRPLNDAA KSFGVSRSTF KRICRGLGIK RWQSGKRRMK  540
GNFSSRLGKG INQEQPGRRN FGSTSMAAVN ETVVAHSSQD LNKMTVKATY KDVTIRFKLP  600
DLSGIAELEN NVIERLHLGR NNFTIKYQDE EGDLVLIACD KDVRECIEIS RSLKETTIKL  660
LLDPPLNRNA L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226093.10.0PREDICTED: protein NLP7-like isoform X1
TrEMBLA0A175YJP10.0A0A175YJP1_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.12e-41Nin-like family protein