PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 640aa    MW: 72867.4 Da    PI: 5.6628
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030926genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK48.12.2e-15458501245
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWP 45 
                  +++++le++sk+F  p++dAAk+ gv+ ++ KriCR +GIkRW 
  DCAR_030926 458 KEDMNLENVSKHFGRPLNDAAKSFGVSRSTFKRICRGLGIKRWQ 501
                  57899**************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.404.2E-538109IPR029016GAF domain-like
PROSITE profilePS5151911.763437531IPR003035RWP-RK domain
PfamPF020423.0E-14461500IPR003035RWP-RK domain
SuperFamilySSF542771.54E-17550633No hitNo description
PROSITE profilePS5174519.853551633IPR000270PB1 domain
SMARTSM006667.4E-18551633IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.6E-16553628No hitNo description
PfamPF005644.3E-15554630IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MWVLSYKTNE EGEDYCELST QNEPFYIVSD DDDGGLASYR MHSVTHKIMP DEVNKVEGQK  60
QEGVISRVLR NKRPEMSPDI SCYSLQEYPH RDFALSCGIR SSLCVPIYQY IYSYECPGGV  120
LEFVSTSADQ LENFRNSCRY YEAFVFRGTK MYLMIDQIYC DPRRLYLRRN VEMDHLLTVV  180
CQKYPIPLAQ YWEVRDVNVR DLGVVNQESN IDFPNVTPWL QFKNACKNIG LYIDQGLVGK  240
SYLSHKSFLC RDIKEFSITT YPLAHYAPNC RPIPCFTICL CSFKPRYREY VLELFLPSQE  300
MDSYDPRTLL NSLMETMKEH LPDYMVASGE KLGQVLSVEV IKSSAHDKPE YLKIGEPQSS  360
LPPQEGSRNE GNASHQFPLS LHSLFKGGAV QDGNVQNIEE TDSTMNSYEE IATGETSTSR  420
PNIVADTIHA DESVQESPVN NIAYALTNED VNYALNNKED MNLENVSKHF GRPLNDAAKS  480
FGVSRSTFKR ICRGLGIKRW QSGKRRMNGN FSSRLGKGIN QEQPGRRNFG STSMAAVNDT  540
VVAHPSQDLN KMIVKATYKD ITIRFKLPDL PGIAELENNV IERLHLERNN FTIKYQDEDG  600
DLVLIACDKD ARECIEISRS LKETTIKLLL DLPLNHNAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226040.10.0PREDICTED: protein NLP7-like isoform X1
TrEMBLA0A175YJ120.0A0A175YJ12_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.15e-44Nin-like family protein