PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 819aa    MW: 93356.1 Da    PI: 5.9012
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030922genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK43.65.8e-14519561244
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44 
                  ek+ s e ls++F  p+ d+Ak  g++ ++ Kr+CR +GIkRW
  DCAR_030922 519 EKKFSYESLSQHFGRPLDDVAKRFGISRSTFKRKCRDLGIKRW 561
                  79999************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.402504589IPR003035RWP-RK domain
PfamPF020425.3E-12523561IPR003035RWP-RK domain
SuperFamilySSF542772.84E-17613701No hitNo description
PROSITE profilePS5174519.189617698IPR000270PB1 domain
SMARTSM006667.3E-19617698IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.6E-18619694No hitNo description
PfamPF005643.3E-14623697IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MIINFGHDEV TANDAATRNI LIQFWEASTE ATEGGRRYCE LTIPENSFEI LPYEVGGLSL  60
YRMHSISCTH RIQLDDEEDD YIIQSKQQEG VISRVFRYKR PEMTPHISFY SLHEYPHREF  120
ALSCGIQPSL CFPLFKTADC SGHPRGVVEL VSTCEQDLEN FKQYFESCFF VQDLNPALWQ  180
MDHVLTLVCQ KFPLHLAQFW VLTNPKLGAL SVMSQKSNLD SEELAPLCRF KDACLQTHLN  240
IGEGLVGKTC LFRKSFSCRN IKKFNITNYP LAHYARSCVS IACFTIFLRS FFPPFGECVL  300
EFFLPSQELS NYYPQTMSNS LLTTVKEHLP YYTFDLGEEL GEVPTLEVIN SSSTREIFKR  360
THKNAVAVIN LDELEESSVK LIEPQSLTPK PNRSKEIIDE ANTMEINHFS LEITLEEAIR  420
NREYTVAARR VDELLEDVGH DKTTAVGSSS QTRISLPHQE VEEEKLTADT SVQKLILTED  480
VFRIKNKGII VGAENVDRPI QFVSKTSLQD ELETEKQAEK KFSYESLSQH FGRPLDDVAK  540
RFGISRSTFK RKCRDLGIKR WQYGRRSTDD NVSSKLRERL NAKEPSKRRY TCSGISSVQD  600
KCLNKVATAD KRQDPKKMIV EATYYDATIR FELPGFTIAE LEDNINERLH LERQSFVIKY  660
EDDEGDWISI ACDEDLQECV EISKSSNNTT IKMSLDPRIN PQAQCISVYP SIVAGKFEWN  720
SLGVMSPHQF ILSNYSMQLN VAFINIAPTR ARENNNHAIV GILGIAVTVL LSALQLKYQA  780
GTGSAFQDHP RAMVFAIASF LVFCLVCDLE QYFRSTHK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226060.10.0PREDICTED: protein NLP7-like
TrEMBLA0A175YIN20.0A0A175YIN2_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.18e-31Nin-like family protein