PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 601aa    MW: 68147.3 Da    PI: 6.2929
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030919genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP229.81.5e-092266155
          AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                 ++y GV+ d+  g W+A           + +s+g+f+t+eeAa a ++a+ +l+g
  DCAR_030919 22 CRYMGVSKDS-FGGWEAK---------IRGVSIGNFDTEEEAALAFDHAAFRLRG 66
                 689****999.9******.........499***********************98 PP

2RWP-RK21.16.1e-072743071245
       RWP-RK  12 kyFslpikdAAkeLgvclTvLKriCRqyGIkRWP 45 
                  ++F +   d+ +  +v+ +  KriCR  GIkRW 
  DCAR_030919 274 SHFGGLRDDVTNLFNVSRSKFKRICRDDGIKRWR 307
                  67777778999999*******************5 PP

3RWP-RK31.14.5e-10431474447
       RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhR 47 
                  e s + ls++F +   d+Ak+ +v+ +  KriCR +GIkRW + 
  DCAR_030919 431 EYSYDILSAHFGKLQDDVAKHFNVSRSKFKRICRDNGIKRWRSH 474
                  55677899*********************************655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000187.80E-162275No hitNo description
PfamPF008477.6E-52266IPR001471AP2/ERF domain
SMARTSM003808.5E-132380IPR001471AP2/ERF domain
PROSITE profilePS5103214.1042374IPR001471AP2/ERF domain
SuperFamilySSF541712.88E-112374IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.103.2E-132375IPR001471AP2/ERF domain
PRINTSPR003672.9E-62435IPR001471AP2/ERF domain
PRINTSPR003672.9E-65676IPR001471AP2/ERF domain
PfamPF020421.2E-6274306IPR003035RWP-RK domain
PROSITE profilePS5151910.137420499IPR003035RWP-RK domain
PfamPF020423.8E-10435475IPR003035RWP-RK domain
SuperFamilySSF542771.24E-17507597No hitNo description
Gene3DG3DSA:3.10.20.2406.1E-19512592No hitNo description
PROSITE profilePS5174518.443512594IPR000270PB1 domain
SMARTSM006664.5E-18512594IPR000270PB1 domain
PfamPF005641.9E-14513592IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDDSVTSMIR ALYEVVYVKS VCRYMGVSKD SFGGWEAKIR GVSIGNFDTE EEAALAFDHA  60
AFRLRGRNAK LNFPNYSAKG ELMSPDRPLT SHEKRVERGA DAMDFGSGLC VGADTGELLA  120
QSNKFIAPEE NEEANMFQAQ DGAHAFQQCP NVEFDWDAIT PQEGVAVGNQ GDAVKELYGQ  180
DDWYAIYAET QSSNFQTEKS PPHQETMEIE EDRLMLDHSH QLPIVEDSMH IKGLIVGAEK  240
VDSYIHVSHK TCIAETSKEG KPSENEYSYD IRSSHFGGLR DDVTNLFNVS RSKFKRICRD  300
DGIKRWRSCK KKLDSRRSSK LVRVSDEDPG EQILIFRASR GVLENQWMMS FHKKLHFAGD  360
AAQELHVQDG YATNAETQSS NFRTEKSPPH QHTMHKYGLV VGAEKVDSCN HVLHKTCIEE  420
TSKEGKPSEN EYSYDILSAH FGKLQDDVAK HFNVSRSKFK RICRDNGIKR WRSHKKKLDS  480
RRSSKLGRVS DEDPSRTDSY CPGIPPLQDT DMITVKATYN EVAIKFELLD SSRMVDLEDS  540
VIERLKVERD TFSIKYQDDE GDWVLIACDK DLQNCIKTSR LSEKTTIKML VDRPIKHYAS  600
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017224049.10.0PREDICTED: uncharacterized protein LOC108200421 isoform X2
TrEMBLA0A175YJB80.0A0A175YJB8_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-17NIN like protein 7