PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 394aa    MW: 44462.1 Da    PI: 5.6132
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030918genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK36.68.8e-12223265446
       RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPh 46 
                  +is e ls++F +++ +A    gv+ +  Kr+CR  GIkRW +
  DCAR_030918 223 TISKESLSQHFGKSLDEAREIFGVSRSEFKRRCRDVGIKRWQY 265
                  6999*************************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.9204293IPR003035RWP-RK domain
PfamPF020421.5E-10223263IPR003035RWP-RK domain
PROSITE profilePS5174516.251308382IPR000270PB1 domain
SMARTSM006664.0E-15308388IPR000270PB1 domain
PfamPF005645.3E-15309389IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.5E-14312389No hitNo description
SuperFamilySSF542775.56E-14312391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MLAAADGEQL GQADVVLEIQ KCATNIYLYE EISITATSKR TPEGVEHIIS LDELEQHMPS  60
KSIEPRSVTS QPTKSVKILE DERNTVISEL RGRDGAMKTH HSALGGTSEE IVKEHAVAVE  120
RDEPIEESAA DDFEYAARYE DVGHAMITAS QPSSLQTMKS LPQQVNMKKM VLENEGDAST  180
QLPCNLQRCE DGTEQEEQVL EMQKSTPIIN SHKVDKLQEA PPTISKESLS QHFGKSLDEA  240
REIFGVSRSE FKRRCRDVGI KRWQYGKRKM GSNSSSKHKQ RLNNGYSTNM PHVQDQPVIS  300
HTTRVLNTMD EKVMYNGLIL RFELPELSGI SELEDNVIKR LHLDKQSFSI KYEDDGGHWV  360
LITCDEDVQY CMKMSRLWKK TTINMLVSQT ANH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017225463.10.0PREDICTED: uncharacterized protein LOC108201687
TrEMBLA0A175YII50.0A0A175YII5_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12836219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.14e-15NIN like protein 7