PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 341aa    MW: 37206.2 Da    PI: 7.2968
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030793genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.83.6e-161011322455
      G2-like  24 sekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    +AtPktil++m+vkgLtl+h+kSHLQkYRl
  DCAR_030793 101 RTQATPKTILRTMGVKGLTLYHLKSHLQKYRL 132
                  578****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.31E-696135IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-10102133IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.6E-15102133IPR009057Homeodomain-like
PfamPF143792.5E-26176222IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MYSAIHSLSE MDGDGEFHGS LDGSNVVVGG DPRLEGYLVG DILNLFTSRF NRSSAVKAGY  60
QALKSQVIGP FEGALSLWPC RSRVEGESTA VCVSRHHMAS RTQATPKTIL RTMGVKGLTL  120
YHLKSHLQKY RLGKQSCKEL AENSKDASCI AESHDTDLST SASSRIAAQN LNDGYHVTEA  180
LRVQMEVQKR LHEQLEVQHR LQLRIEAQGK YLQSILEKAC KALNDQTLAS VGLEAAREEL  240
SELAIKVAND CQQVMTVSSL SDVAATLERK NLTNMHARIG DCSVDSCLTT NESPVSPIGV  300
RLQAGALKKR PRPRPISSDA DLSPLQSSLP QMEWMMSDIS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1308312KRPRP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017227106.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ94A571e-81PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A175YHQ60.0A0A175YHQ6_DAUCS; Uncharacterized protein
STRINGXP_002518104.11e-113(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.17e-74G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]