PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030236
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 571aa    MW: 62846.1 Da    PI: 5.0615
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030236genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.43.6e-1391985671374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv++L++cAeav+ ++l+la+al++++  la ++  +m+++a+yf+eALa+r++r        l p+++++  s+ + + +  f+e++P+lkf+h+ta
  DCAR_030236 198 LVHTLMACAEAVQGNNLKLAEALVKQIGFLAVSQIGAMRKVATYFAEALARRIYR--------LYPQNSQD--SAFTDMLQMHFYETCPYLKFAHFTA 285
                  689****************************************************........44555553..4444445556*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIlea++ +++vH+iDf+++qG+QWpaL+qaLa Rp+gpps+R+Tg+g+p+++ ++ l+e+g++La+fAe+++v+fe++ +va++l+dl+ ++L++
  DCAR_030236 286 NQAILEAFADKKMVHVIDFSMKQGMQWPALMQALALRPSGPPSFRLTGIGPPSHDGTDHLQEVGWKLAQFAETIHVKFEYRGFVANTLSDLDASMLDL 383
                  ************************************************************************************************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak.........lpreseerikv 285
                  ++gE++aVn+v++lh+ll++++ +e+    v+++v +++P++v+vveqea+hn++ Fl+rf+e+l+yys+lfdsle+          +   s++++++
  DCAR_030236 384 REGETVAVNSVFELHQLLARPGGIEK----VMSAVADMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLESCgnnvsgvdgAEIVSNQDKVM 477
                  *************************9....*********************************************98777888877655667****** PP

         GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++++lgr+i+n+vaceg +r+erhe l +W +r+++aGF+pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  DCAR_030236 478 SEVFLGRQICNIVACEGVDRVERHEPLTQWTDRFNSAGFEPVHLGSNAFKQASMLLALFAgGDGYRVEEHEGCLMLGWHTRPLITTSAWK 567
                  *****************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011294.1E-2956129No hitNo description
PfamPF120412.8E-3156122IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098565.924172546IPR005202Transcription factor GRAS
PfamPF035141.3E-136198567IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MKRDHPHPHP LPHPQPNQPS FSDCPGGSSS TITDNIYSPG KSKMPWNDCE QDAGVDELLA  60
VLGYKVKSSD MIDVAEKLQH LEEAMGQAHQ EGITQLGSDT VHYNPSDLSS WLESMIGELN  120
PPEIGTQSSI IFDDSVSDYD LKAIPGKAVF TNQNQNQPVC KKQKTVALPA VSSPWPVSSV  180
ETQPVQVLVD SQENGVRLVH TLMACAEAVQ GNNLKLAEAL VKQIGFLAVS QIGAMRKVAT  240
YFAEALARRI YRLYPQNSQD SAFTDMLQMH FYETCPYLKF AHFTANQAIL EAFADKKMVH  300
VIDFSMKQGM QWPALMQALA LRPSGPPSFR LTGIGPPSHD GTDHLQEVGW KLAQFAETIH  360
VKFEYRGFVA NTLSDLDASM LDLREGETVA VNSVFELHQL LARPGGIEKV MSAVADMKPE  420
IVTVVEQEAN HNGPVFLDRF TESLHYYSTL FDSLESCGNN VSGVDGAEIV SNQDKVMSEV  480
FLGRQICNIV ACEGVDRVER HEPLTQWTDR FNSAGFEPVH LGSNAFKQAS MLLALFAGGD  540
GYRVEEHEGC LMLGWHTRPL ITTSAWKLSG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6219356614378Protein SCARECROW
5b3h_A2e-6219356613377Protein SCARECROW
5b3h_D2e-6219356613377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226742.10.0PREDICTED: DELLA protein GAI1-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A175YH210.0A0A175YH21_DAUCS; Uncharacterized protein
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein