PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 641aa    MW: 70540.5 Da    PI: 8.0186
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030077genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.91.9e-27459514156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+p+LH+ F+ a+e+LGG+ +AtPk+i+e mkv+gLt+++vkSHLQkYR +
  DCAR_030077 459 KARRHWSPDLHRLFLAAIEELGGAFVATPKQIKEKMKVDGLTNDEVKSHLQKYRFH 514
                  68****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF559206.93E-6582314IPR000994Peptidase M24, structural domain
HamapMF_0197430.357117405IPR002467Peptidase M24A, methionine aminopeptidase, subfamily 1
TIGRFAMsTIGR005001.2E-63120314IPR002467Peptidase M24A, methionine aminopeptidase, subfamily 1
Gene3DG3DSA:3.90.230.104.7E-72121315IPR000994Peptidase M24, structural domain
PfamPF005575.3E-44127317IPR000994Peptidase M24, structural domain
CDDcd010862.02E-99128314No hitNo description
PRINTSPR005992.0E-14182195IPR001714Peptidase M24, methionine aminopeptidase
PRINTSPR005992.0E-14204220IPR001714Peptidase M24, methionine aminopeptidase
PRINTSPR005992.0E-14274286IPR001714Peptidase M24, methionine aminopeptidase
PROSITE profilePS5129412.761456516IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-23457514IPR009057Homeodomain-like
SuperFamilySSF466891.08E-13458514IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24459514IPR006447Myb domain, plants
PfamPF002491.0E-6461512IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
GO:0004177Molecular Functionaminopeptidase activity
GO:0008235Molecular Functionmetalloexopeptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MAVLLSRPNL RVYANHEAFL SSSSSLVMGT HVTSFTPFSG KNSSCQKRLL VSAKRISGLE  60
EAMRIRRERE LNGTPTASRR RPPLRRGRVS PRLLVPDHIQ LPPYTSSNEV PEISSEFQIP  120
DAEGIVHMRA ACELAARVLD YAGTLVRPSV TTNEIDKAVH QMIIDAGAYP SPLGYGRFPK  180
SVCTSVNECM CHGIPDSRQL QDGDIINIDV TVYLNGYHGD TSKTFLCGNV NTATKRLVKV  240
TEECLEKGIA VCKDGAPFRK IGKRISEHAE KFGFGVVDRF VGHGVGTIFH SEPLIFHCRN  300
EFPGVMVEGQ TFTIAIEACR KEMSLQGNSE SYEQTFKGGP VFEEFIPMKN VISDSPDESE  360
QRGDNKNGKN VVSSSDDCSN DGSTKSDWLK SVQLWNHTPD QSTDKDLIRE LSVTEVQKNG  420
SAEAFQFQPV SCAQRQEVTI PRVSSTTESG GGRGGGSSKA RRHWSPDLHR LFLAAIEELG  480
GAFVATPKQI KEKMKVDGLT NDEVKSHLQK YRFHERPSSS SSTQETQTQS NLLPSPPPAP  540
QFVVLGGLWV PPLNYACTVT DTTILHSAPD RIYAPEPLRA QTDTMILHSP PDRIYAPKPL  600
RAQLPENVAT RLLQKRKRSD QARNHHNGSY GSDSSATSSD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4iu6_A1e-632731930331Methionine aminopeptidase 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A175YH740.0A0A175YH74_DAUCS; Methionine aminopeptidase
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA321822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-41G2-like family protein