PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030068
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 193aa    MW: 21945.7 Da    PI: 6.3526
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030068genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.43.1e-1384139560
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                  +++rr+++NRe+ArrsR RK++ ++eL   v  L +e  +L+++l++ ++  +k+ 
  DCAR_030068  84 RKQRRMISNRESARRSRMRKQKHLDELLSQVYRLRTEKNDLIDKLNNVSESHDKVL 139
                  689******************************************99999887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-1080144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.31282145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-1084156No hitNo description
SuperFamilySSF579591.13E-1184133No hitNo description
PfamPF001703.1E-1184142IPR004827Basic-leucine zipper domain
CDDcd147021.72E-1885136No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MMFPSEFLGT QTLAQECISH VDNNCSVIQS NMSPLQDFDN FLAKYMTLQN AIPGPDFNSQ  60
SSCVSNNSTS DEGDELHLSI INERKQRRMI SNRESARRSR MRKQKHLDEL LSQVYRLRTE  120
KNDLIDKLNN VSESHDKVLL ENARLKEEAS NLRRMVTDIQ LASTYNGLRD LEELPCTTPH  180
LIANTSPNCK TV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196103RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017225769.11e-141PREDICTED: basic leucine zipper 43-like
TrEMBLA0A175YFW81e-139A0A175YFW8_DAUCS; Uncharacterized protein
STRINGcassava4.1_022183m1e-64(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-39basic leucine-zipper 42