PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_029974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 471aa    MW: 52897.5 Da    PI: 5.7733
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_029974genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS458.53.9e-140464671374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lLl+cA++v++g+le+a+ +  ++s+laspdgd+mqR+a+yfteALa+r+++ +++lykal++++ s    se + a+k+f+e +P+lk++++++
  DCAR_029974  46 LIHLLLTCATHVATGSLENANLIFDQISHLASPDGDTMQRIASYFTEALANRILKVWPGLYKALHSTDIS--LFSEDIVARKMFFEFFPFLKVAFVIT 141
                  689*************************************************************999997..79************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaI ea+ege++vHiiD+++ + +QW aL+q L++Rpegpp+lRiTgv++     ke l +++  L++ Ae+l++pf+fn+ ++++le+l++e+Lrv
  DCAR_029974 142 NQAIIEAMEGEKMVHIIDLNAAESMQWRALIQDLSARPEGPPHLRITGVHP----VKEVLDKMACVLTEEAEKLDIPFQFNP-IVSKLENLDIEKLRV 234
                  ***************************************************....9**************************.7999*********** PP

         GRAS 197 kpgEalaVnlvlqlhrll........................................................desvsleserdevLklvkslsPkv 238
                  k+gEala++++lqlh+ll                                                        ++s++   + d +L+++++lsPk+
  DCAR_029974 235 KTGEALAISSALQLHTLLspadephqrthvtpmnsdgvpldktsqmkegtlgdflqkdminghspgtdsessspQSSTAAV-QLDGFLNALWGLSPKI 331
                  ********************************************************************9987743333333.69************** PP

         GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                  +vv+eq+++hn+++++er++e+l++y+alfd+le++lpr+s er k+E++l+g+ei+n++aceg+ r+erhe+le+W +rle aGF++vpls++ + q
  DCAR_029974 332 MVVSEQDSNHNGSNLMERLSESLYFYAALFDCLESTLPRTSTERLKLEKFLFGEEIRNIIACEGRGRKERHEKLERWIQRLEFAGFGKVPLSYYGMLQ 429
                  ************************************************************************************************** PP

         GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  a++ll+ ++ dgyr++ee+gs+v++W+drpL+sv+aWr
  DCAR_029974 430 ARRLLQSYSCDGYRIKEENGSVVICWQDRPLFSVCAWR 467
                  *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.20420447IPR005202Transcription factor GRAS
PfamPF035141.3E-13746467IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MFQDDGSSSV TSSPFQNSPY NLMSPGLGSP YPWLKELKSE DRGLYLIHLL LTCATHVATG  60
SLENANLIFD QISHLASPDG DTMQRIASYF TEALANRILK VWPGLYKALH STDISLFSED  120
IVARKMFFEF FPFLKVAFVI TNQAIIEAME GEKMVHIIDL NAAESMQWRA LIQDLSARPE  180
GPPHLRITGV HPVKEVLDKM ACVLTEEAEK LDIPFQFNPI VSKLENLDIE KLRVKTGEAL  240
AISSALQLHT LLSPADEPHQ RTHVTPMNSD GVPLDKTSQM KEGTLGDFLQ KDMINGHSPG  300
TDSESSSPQS STAAVQLDGF LNALWGLSPK IMVVSEQDSN HNGSNLMERL SESLYFYAAL  360
FDCLESTLPR TSTERLKLEK FLFGEEIRNI IACEGRGRKE RHEKLERWIQ RLEFAGFGKV  420
PLSYYGMLQA RRLLQSYSCD GYRIKEENGS VVICWQDRPL FSVCAWRCKR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-39344667378Protein SCARECROW
5b3h_A3e-39304662377Protein SCARECROW
5b3h_D3e-39304662377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017227317.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A175YFV10.0A0A175YFV1_DAUCS; Uncharacterized protein
STRINGEOY328060.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]