PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_029869
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 971aa    MW: 106017 Da    PI: 5.2349
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_029869genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29573624152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  DCAR_029869 573 AEKSISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 624
                  589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.723563644IPR003035RWP-RK domain
PfamPF020423.7E-26577624IPR003035RWP-RK domain
SuperFamilySSF542772.03E-22875960No hitNo description
PROSITE profilePS5174525.183876958IPR000270PB1 domain
SMARTSM006661.3E-24876958IPR000270PB1 domain
PfamPF005646.4E-19876957IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.9E-25876957No hitNo description
CDDcd064078.05E-36877957No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 971 aa     Download sequence    Send to blast
MSEPQAVEDE DKSKNSTRKP GNSASYPVGL IDRESLMMMD VDLDLDASWI FDQISTDPAS  60
PFLLSDQPFS PLWPFSDDAS ALSAPLTGVS LPLLPSCDPQ LTYDNKQCSS NDKKSLPSPL  120
LGLVPLDYSD GSCLIKERMT QALRYFKEST EQHVLAQIWA PVKKGDRYVL TTSGQPFVLG  180
LNSSGLHQYR MASVMYMFSV DGESNLLGLP GRVFQQKLPE WTPNVQYYSS KEYPRLDYAL  240
HYNVQGTLAL PVFEPSGGAC LGVLELIMTS QKINYAPEVD KVCKALEICN KGRQNALAEI  300
LEVLTLVCET HKLPLAQTWV PCRHRSVLAY GGGLKKSCSS FDGSCMGQVC MSTTDVAYYV  360
VDYHMWGFRE ACAEHHLLKG QGVAGRSFSS QSSCFCEDIT KFSKTEYPLV HYARMFGLSS  420
SFAICLQSSH TGNDNYILEF FMPPNTLEGN KHYTMLDTML ATMKKQFRSL KVASGKELDE  480
EGRSVEVIEA SSDGDPDSRI ISVQKLESNV IPCTVTRDGE NGHVDLSGKP IIQKSDAVTN  540
IANVAGSGEI SNGAPLSENK DAKKKSERKR GKAEKSISLE VLQQYFAGSL KDAAKSLGVC  600
PTTMKRICRQ HGISRWPSRK INKVNRSLSK LKRVIESVQG AEGTFTLTSL AKSSLPAGVG  660
SVSWPVSLNG SSPQNSPVSI PSEVRAEINN DGQAENIDLP SGGRLQCEDE YIHLQGGYIP  720
ELGEGSNRSK TGSGSREHST GTPTSHASAQ GSPFNVNNSS QNDQVVSLLG EDCLKVGASF  780
EMARQPIKEA NLPVAFPVPN VVVGAETEEL FGGMLIEDAG SSHDLTNLCQ TGGTFPDERI  840
PESSWANQPP SDEFLKGSVP HLEEKPQIPS RTEVKTVTVK ATYKEDIIRF RLPLSSGIIK  900
LEEEVSKRVK LEVGTFDLKY LDDDQEWVLI ACDADLQECV EISRSSGRNI IRLLVQDIMA  960
NLGSSCESSG *
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017226568.10.0PREDICTED: protein NLP6 isoform X2
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A175YFV20.0A0A175YFV2_DAUCS; Uncharacterized protein
STRINGEOY250900.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]