PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_029264
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 375aa    MW: 42150.6 Da    PI: 7.8458
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_029264genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.65.7e-082432891763
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +e+
  DCAR_029264 243 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFLNQQNLILSMEN 289
                  89***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.2E-4232291IPR004827Basic-leucine zipper domain
CDDcd147032.27E-16234282No hitNo description
SuperFamilySSF579597.74E-6243285No hitNo description
Gene3DG3DSA:1.20.5.1704.5E-8243285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MANSKGPSSF RSMMHNGKHS LLPPKSPFPS ITPSYVDYVP SPAIGVKGMP KPRDGNSYHQ  60
RTSSESVLIE DQPSWLDELL NEPETPVGRG HRRSSSDSFA YTDALSAANI SYAAQNEYRP  120
KNMTTIHSWK SQDLDFYKDA HNASFYADAN SFSKIKNRSW NSPSYVMAHP SGNLCSKDNF  180
IRHNSVSECA SHEADQFPSN AEKLNTPESG SHDAKASSER KDLSYARTPA SETDTKRAKQ  240
QFAQRSRVRK LQYIAELERN VQALQAEGSE VSAELEFLNQ QNLILSMENK ALKQRLENLT  300
QEQLIKYLEH EVLEREIERL RTLYQQQQQQ PHQQPPPSHQ RAKSRDLDSQ FASLSLKHKD  360
SSSGTDSVAG PLNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017224019.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A175YEL10.0A0A175YEL1_DAUCS; Uncharacterized protein
STRINGcassava4.1_009724m1e-166(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27651733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-109bZIP family protein