PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_028933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 637aa    MW: 69255.2 Da    PI: 5.5368
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_028933genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.21.5e-1272716322374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   +lLl+cAeavs++++e+a+++L ++sel++p g++ qR+ ayf eA++arl++s+ ++y++lp++  +  + +++++a+++f+ +sP++kfsh+taN
  DCAR_028933 271 LKLLLQCAEAVSADNFEEANTMLLEISELSTPFGTSAQRVGAYFSEAMSARLVSSCLGIYASLPATVVP-LHGQKVASAFQVFNGISPFVKFSHFTAN 367
                  689************************************************************998886.6899999********************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  qaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpps+R+Tg+g       e+le+tg+rL++fA++lg+pfef++ va+++ +l++e+++v+
  DCAR_028933 368 QAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPSVRLTGFGT----CMEALEATGKRLSDFADKLGLPFEFSP-VADKVGNLDPERINVS 460
                  **************************************************....***************************.7*************** PP

         GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                  ++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h++ sFl rf+ea++y+salfdsl a++++eseer++vE++ll+rei+
  DCAR_028933 461 KKEAVAVHWLQ--HSLYDVTGSDAN----TLWLLQRLAPKVVTVVEQDLSHTADSFLGRFVEAIHYFSALFDSLGASYGEESEERHVVEQQLLSREIK 552
                  **********9..999999999999....********************************************************************* PP

         GRAS 296 nvvacegaerrerhe.tlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  nv+a  g +r e  e ++++Wre+l+++GFk ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaW+
  DCAR_028933 553 NVLALGGPSRSEGGElRFNNWREKLQQSGFKGISLAGNAAAQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWK 632
                  **********9987758**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.663244612IPR005202Transcription factor GRAS
PfamPF035145.0E-125271632IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MDGSSHQSAS PSVCVFSGLP LFPPVLQQQQ QPLLSSPTNS SIGTQVGGIN SHSNSSAAMV  60
WIDGIIKDLI HTSSSVSIPQ LIQNVKEIIH PCNPSLAALL ESRLRTLTTT TMDPDYFTTT  120
RKETSSSSPI IRNSHYPPPP YHNLQMATVG QPQLHQGQGS SAAPPTGLAV YRGDVEDNIA  180
ASVNHYNNNW GLPQTATGGS NEAMPTDHIP VMFPNQIKMH EDSQLQQIET LPPPPAASDA  240
SQVMDDAAVI REKRKQEIRQ LKRDEEGLHL LKLLLQCAEA VSADNFEEAN TMLLEISELS  300
TPFGTSAQRV GAYFSEAMSA RLVSSCLGIY ASLPATVVPL HGQKVASAFQ VFNGISPFVK  360
FSHFTANQAI QEAFEREDRV HIIDLDIMQG LQWPGLFHIL ASRPGGPPSV RLTGFGTCME  420
ALEATGKRLS DFADKLGLPF EFSPVADKVG NLDPERINVS KKEAVAVHWL QHSLYDVTGS  480
DANTLWLLQR LAPKVVTVVE QDLSHTADSF LGRFVEAIHY FSALFDSLGA SYGEESEERH  540
VVEQQLLSRE IKNVLALGGP SRSEGGELRF NNWREKLQQS GFKGISLAGN AAAQATLLLG  600
MFPSDGYTLV EDNGTLKLGW KDLCLLTASA WKPLYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.02546333380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017220751.10.0PREDICTED: protein SCARECROW-like
SwissprotQ9AVK40.0SCR_PEA; Protein SCARECROW
TrEMBLA0A175YJB20.0A0A175YJB2_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_1018.10.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82582430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein