PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_028852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 494aa    MW: 55737.7 Da    PI: 6.4346
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_028852genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.62.4e-27246300155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+rl+Wt+eLH+ F +av+qLGG+ +AtPk il++m    +t++hvkSHLQkYR+
  DCAR_028852 246 KERLKWTQELHDLFEKAVNQLGGPYRATPKGILKAMRKSEITIYHVKSHLQKYRM 300
                  68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF121657.9E-5910148IPR021998Alfin
SuperFamilySSF579031.24E-9188225IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.106.5E-9192226IPR013083Zinc finger, RING/FYVE/PHD-type
Gene3DG3DSA:1.10.10.604.5E-25245301IPR009057Homeodomain-like
SuperFamilySSF466892.33E-14245300IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-21246301IPR006447Myb domain, plants
PfamPF002491.3E-7248299IPR001005SANT/Myb domain
PfamPF143793.2E-15332374IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0042393Molecular Functionhistone binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MASISSTPRT VEEIFKDYSG RRAGIVRALS FDVDEFYGLC DPDCVSAGGN GNNGLEKENL  60
CLYGHPNETW EVSLPAEEVP PELPEPALGI NFARDGMNRK DWLSLVAVHS DCWMLSVAFY  120
LGARLNRNER KRLFSLINEL PTVFEVVTER KPVKEKPSGD SGSKYRASTK RSSDGQVKSI  180
PKMADESFEE DEDEHSETLC GSCGGNYNPD EFWIGCDICE RWYHGKRPEG FSSSNMGSSR  240
SDSAAKERLK WTQELHDLFE KAVNQLGGPY RATPKGILKA MRKSEITIYH VKSHLQKYRM  300
SKFIPETPSK NKFERRSISE ILPNFSATSG AQLNEALQMQ MAAQKRMNDQ HEVQRNLKVK  360
IEAQGRFLER IAEDYKNCPN IAKRAKFLSP TSLPSLCEES ESSAKEFESD FENKTEITSD  420
EKFPAPKRLQ MECDNFQQIY SKYASVASDT HLQQCVLTPK RSKISYQSPE ISFPWNAAAY  480
CQSPLMPASY GSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5xvl_A4e-5771532135PHD finger protein ALFIN-LIKE 2
5xvw_A4e-5771532135PHD finger protein ALFIN-LIKE 2
5xvw_B4e-5771532135PHD finger protein ALFIN-LIKE 2
5xvw_C4e-5771532135PHD finger protein ALFIN-LIKE 2
5xvw_E4e-5771532135PHD finger protein ALFIN-LIKE 2
5y21_A4e-5771532135PHD finger protein ALFIN-LIKE 2
5y21_B4e-5771532135PHD finger protein ALFIN-LIKE 2
5y53_A4e-5771532135PHD finger protein ALFIN-LIKE 2
5y53_B4e-5771532135PHD finger protein ALFIN-LIKE 2
5y53_C4e-5771532135PHD finger protein ALFIN-LIKE 2
5y53_E4e-5771532135PHD finger protein ALFIN-LIKE 2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017223304.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A175YJ250.0A0A175YJ25_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-44G2-like family protein