PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_028749
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 526aa    MW: 58431 Da    PI: 4.8094
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_028749genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS56.84.8e-18390462173
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn 73 
                  l++lL++cA+av+++d ++a+ lL+++++++sp gd +qRla++f+ +L+arla++++++ kal++ + + ++
  DCAR_028749 390 LRTLLISCAQAVAADDRRNANDLLKQIRQHSSPFGDGNQRLAHCFADGLEARLAGNGTQIHKALQCYKIPMNS 462
                  6789************************************************************998887554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098512.582364525IPR005202Transcription factor GRAS
PfamPF035141.7E-15390462IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MDALNGVQWG SWGNQSEIVF SDRKVVRGAR FEHGVPDQEL RRIENGFLGQ GQVDGRRIEN  60
GFLSQELSGI ELVPNPPTLT HVAPSSSVSA EDGSQEDCDF SDAILGYISQ VLMQEDMGDQ  120
TCMLQDSLDL QAAEKPFYDV LGKKYPPSPQ QGLPDLGDQY RFGLNEQDAV ADYGQFIDPY  180
WSNYPVDYNG SQVQTPLAST VTHTMVNPAN SSIKFIDGFL DSPISPLQVR DLYNESQSIW  240
QFKKGVEEAN KFLPSSNNTL VNYNFNELIP QDLQINTSEL ATEVERSNEL QYLPTGSRGR  300
KISHRDDIGI EQERTSKLAA VYQESTLRDD EFDTVLLCSE GKGKAVLESF RETLRNDKSK  360
FAEQIAQSKG FSRGKGRGKK QTKKKEVIDL RTLLISCAQA VAADDRRNAN DLLKQIRQHS  420
SPFGDGNQRL AHCFADGLEA RLAGNGTQIH KALQCYKIPM NSPIHTSELS SDDWYQMTVQ  480
AELSIEKGLA VAKFCEIDKK IQESGRDKKF GNRDGTTAPV VSGSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017223681.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_017223682.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A175YJS70.0A0A175YJS7_DAUCS; Uncharacterized protein
STRINGXP_009804922.11e-131(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.13e-61GRAS family protein