PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 518aa    MW: 58111.5 Da    PI: 5.3618
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027820genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.42.5e-1271475172374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++Ll+cAe+vs+gd +++  l++ l+  +s +g+pmqRl ay++e+++arl++s+s lyk+l++s+++  +sse ++++ + +++ P++kf+++  N
  DCAR_027820 147 KQVLLACAEVVSNGDISNVAPLMNILERKVSVTGEPMQRLGAYMMEGIKARLMSSGSILYKKLKCSDEP--TSSELMSYMGVIYQIVPFYKFAYMSSN 242
                  689***************************************************************999..59999999999**************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                    I ea+++e+r+HiiDf+i qG QW++L+qaLasRp+gpps+RiTgv+++++   +   l+ +g+rL+k+Ae++gvpfef+  +a + ++++le+Lr
  DCAR_027820 243 AIIEEAMKSESRIHIIDFQIVQGSQWVPLIQALASRPGGPPSVRITGVDDSNAAyaRGGGLQLVGDRLSKVAESCGVPFEFHG-AALSGSEVKLENLR 339
                  **************************************************888899999************************.899*********** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  v++gEalaVn+ + lh+++desvs+e++rd++L+l+kslsPkvv++veqe+++n+++Fl rf e+leyy a+f++++++ +r++++ri+ E+++++r+
  DCAR_027820 340 VRQGEALAVNFPYVLHHMPDESVSTENHRDRLLRLIKSLSPKVVTLVEQESNTNTSPFLPRFRETLEYYEAMFEAIDTTRARDDRQRISAEEHCVARD 437
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivn++acegaer+erhe ++kWr rl++aG+++ +ls+++   +k +l++++++ +r+e+++g+l+l Wk+r Lv++SaWr
  DCAR_027820 438 IVNMIACEGAERVERHELFGKWRLRLSMAGYTQCQLSYDVDGVVKDMLKEYDGN-FRLEHRNGALYLRWKNRDLVTCSAWR 517
                  ****************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.932120498IPR005202Transcription factor GRAS
PfamPF035148.7E-125147517IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MQQVEPYRAS QFQIFNNSVS SDNSSQETPV SFHYDEQFFT LDSFPADYVG YDSPSAASTC  60
SRSPLSVQHS QSNWSEQHQS PDYTYGSPLS GSPMIHDGNK LTFFHKELES KSLGPQSETD  120
DVCSYTFNSV NPEVTSMLQM ISTLDVKQVL LACAEVVSNG DISNVAPLMN ILERKVSVTG  180
EPMQRLGAYM MEGIKARLMS SGSILYKKLK CSDEPTSSEL MSYMGVIYQI VPFYKFAYMS  240
SNAIIEEAMK SESRIHIIDF QIVQGSQWVP LIQALASRPG GPPSVRITGV DDSNAAYARG  300
GGLQLVGDRL SKVAESCGVP FEFHGAALSG SEVKLENLRV RQGEALAVNF PYVLHHMPDE  360
SVSTENHRDR LLRLIKSLSP KVVTLVEQES NTNTSPFLPR FRETLEYYEA MFEAIDTTRA  420
RDDRQRISAE EHCVARDIVN MIACEGAERV ERHELFGKWR LRLSMAGYTQ CQLSYDVDGV  480
VKDMLKEYDG NFRLEHRNGA LYLRWKNRDL VTCSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A8e-5715351626378Protein SCARECROW
5b3h_A6e-5715351625377Protein SCARECROW
5b3h_D6e-5715351625377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017223372.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_017223373.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A175YNR90.0A0A175YNR9_DAUCS; Uncharacterized protein
STRINGPGSC0003DMT4000347630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13