PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 494aa    MW: 54234.5 Da    PI: 5.0576
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027606genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS82.57e-263864861104
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL+ cA+av+++d+++a+ lL+++++++sp+gd mqRla+yf ++L+ar+a+s++++yk+l + + +    +++l+a++l+  +sP+ k+ ++ a
  DCAR_027606 386 LRTLLTLCAQAVAANDQRNASDLLKQIRQHSSPSGDGMQRLAHYFSNGLEARMAGSGTQIYKQLIAFPLT---AADVLKAYHLLLATSPFRKIPNFFA 480
                  5789************************************************************999999...9************************ PP

         GRAS  99 NqaIle 104
                  N++I +
  DCAR_027606 481 NKTIIK 486
                  ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.111360493IPR005202Transcription factor GRAS
PfamPF035142.4E-23386486IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MDYSCKLGFT DGQVRPYCTS SVNPMSFNEV SSQRFLDQKL VNGARIDGKF IDTARVDRPV  60
MPADPNSSGF TPFYGVQHTT DLHEDFDFSD VVLGYINQML MEEDMEEKTC MFQESAALLA  120
AEKSFYEVLG EKYPPPHEEQ PVAYSDQSSE SLDENHVEAY NSDGGNNHLI NSLLTPGCIC  180
DSSDYSLCNS QGGSVRLVAE TSQSIGSLTS NGSPVDGLAD SPVSTLGVTD IFTDSQSALL  240
MKKGYEEASK FLPSGNNFFA DMGTNELLAN GQKKKDETVL VKLEDKNQNE KSHNGSRSRK  300
NPYTEEDGLD ESRSNKHSAL FCESTVRSEM FDMVLLCSEG KYDSALRESL MNDAKKSVQQ  360
NNQPKGSNSG KARGKKQGGK KDVVDLRTLL TLCAQAVAAN DQRNASDLLK QIRQHSSPSG  420
DGMQRLAHYF SNGLEARMAG SGTQIYKQLI AFPLTAADVL KAYHLLLATS PFRKIPNFFA  480
NKTIIKEHLI QVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017223003.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A175YQ800.0A0A175YQ80_DAUCS; Uncharacterized protein
STRINGEOY180431e-139(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.12e-72SCARECROW-like 14