PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 547aa    MW: 62018.4 Da    PI: 5.189
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027006genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS251.43.4e-771795442374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++ Ll  Ae + ++++ela++lL++ +e +s +g+p+qRl+ yf  AL++r+  ++  +  ++ + e + k   +  +   ++++  P+ ++ ++t  
  DCAR_027006 179 IQNLLLSAEKIGEQQFELARSLLNHCNEFCSDKGNPIQRLVYYFSAALRERIDLEMGVTTPKVVSLEFE-KAIMNPSSTSLTLHQRVPFCQVMQFTGV 275
                  6788999*********************************************99555555555555554.455666666667**************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  qaI e v++++r+HiiD++i++G++   ++q LasR   +  +lRiT++g    +s+     tg+rLa+fA++++++f+f+v+++ ++ dl+ + +++
  DCAR_027006 276 QAIIEHVSQAKRIHIIDLNIKYGTHCSIFIQDLASRHaCPVEHLRITALGT---NSNILPTDTGKRLANFAKSVNLSFSFHVVTVADMLDLHENLFEL 370
                  *************************************44556*********...46777899************************************ PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  +++E++aV   + l +l +++  le     ++k+++ ++P v+vv+e+e++hns+ F++rf+eal ++ a fd++ + + +++  r + E + +g  i
  DCAR_027006 371 DTDEVTAVYAPYILWTLISKQDRLEC----LMKVIRIINPCVMVVSENEVNHNSPMFVNRFVEALFFFGAYFDCFGEYMDADDPGRFSAEYM-FGHGI 463
                  *****************966665555....************************************************9**********999.***** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +n+va+ g+er+ r+ +   W + + +  + + +ls +   qa l+ ++++ +d  +++ + +sl+lgWk+ +++s+SaW+
  DCAR_027006 464 KNIVATDGKERTVRQVKNDVWVSFFAQYNMVQKELSRSSLYQATLVAKNFEcEDSCSLKLDGKSLILGWKGTSVLSLSAWE 544
                  ***************************************************9999*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.547152523IPR005202Transcription factor GRAS
PfamPF035141.2E-74179544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MLPFNYLDCT TSADNRHSNR PVERVGEQSQ ISENHTSQGR QQMPFFPGFE RFDELCFNNG  60
SSEASPFQLT QDECTKLRNI HSEMLELFAP EQERSSPTSL SSFRILNKCR SNFEEQNSEK  120
VKVPDSEISC SKVGGQSVIE IIQLAGEKFI KSRSLRIDDL SELSQGPYVD KTEDVEFIIQ  180
NLLLSAEKIG EQQFELARSL LNHCNEFCSD KGNPIQRLVY YFSAALRERI DLEMGVTTPK  240
VVSLEFEKAI MNPSSTSLTL HQRVPFCQVM QFTGVQAIIE HVSQAKRIHI IDLNIKYGTH  300
CSIFIQDLAS RHACPVEHLR ITALGTNSNI LPTDTGKRLA NFAKSVNLSF SFHVVTVADM  360
LDLHENLFEL DTDEVTAVYA PYILWTLISK QDRLECLMKV IRIINPCVMV VSENEVNHNS  420
PMFVNRFVEA LFFFGAYFDC FGEYMDADDP GRFSAEYMFG HGIKNIVATD GKERTVRQVK  480
NDVWVSFFAQ YNMVQKELSR SSLYQATLVA KNFECEDSCS LKLDGKSLIL GWKGTSVLSL  540
SAWEFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-351785434374GRAS family transcription factor containing protein, expressed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017221729.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLA0A175YRS20.0A0A175YRS2_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-43RGA-like 2