PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 580aa    MW: 65440.2 Da    PI: 5.2731
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027005genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS260.94.6e-802075752372
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl....fsevsPilkfs 94 
                  ++ Ll+ Ae v ++++++a++lL++ ++ +s +g+p+qR++ yf +AL++++ ++  +  ++++   + ++   +++l+  +      ++  P+ ++ 
  DCAR_027005 207 IQNLLASAEKVGEQQFSRASHLLSHCHQCSSIKGTPVQRIVYYFSQALQQKIDQE--TGRRKINGAGKMQSLvLQDTLMNPNPsllaSYQKVPFSQVI 302
                  789*************************************************992..22222322222222213333332221333478999****** PP

         GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                   +ta q + e v++++r+HiiD+++ +Gl+   L++aLa+R+  +  +l++T+vg     s+++++etg+rL ++A++l+++f+fnv+++ ++ d + 
  DCAR_027005 303 LFTALQVMIENVSEATRIHIIDLEVRNGLHLSMLMEALAARSdCPLEHLQVTAVGT---ISEHKIKETGKRLISVAQSLNLSFSFNVVMVADMLDHNE 397
                  ******************************************44556*********...689************************************ PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                  ++++++++E+ aV     l ++ d++  le+    ++ ++++++P+v++v+e eadhns+ F++rf+eal yysa+fds+e+ + + +e+ri  E   
  DCAR_027005 398 SHFKLDTKETCAVYAPCILSSMIDRPSRLEH----LMTVIQKINPRVMIVTEVEADHNSPVFVNRFIEALFYYSAVFDSMEECMDHSDEDRIISESIN 491
                  **********************988887777....*************************************************************** PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSa 372
                  lg +i+n+v  eg+er+ rh + + W++ ++++G+ + +ls     qakll+ +++     ++e   +sl +gWk+ p++svSa
  DCAR_027005 492 LGSAITNIVVFEGEERKIRHVNSNVWKAFFSQFGMVETELSRASLYQAKLLVDNFAcASSCTLEMIGKSLSIGWKGTPILSVSA 575
                  ********************************************************9999***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.875180556IPR005202Transcription factor GRAS
PfamPF035141.6E-77207575IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MVIEMFPSEQ ISSRCIPNEF GYSKDYYFRK EGNAERKTQW NGIEECEEWR SYNLFRQNTT  60
TQGNLFLSTK QQGLISSAEI TNFDELCYDI KPLSSQLSLE ELTNFATIHS EFQELITLQE  120
SSSGIKLNNE TKFGQADYEH FDLPIYDTTC ANAGLSERLS TKDFLRLGGE KFIQSSSSVF  180
NNFDLSHPYT TSLSGLSVED HRDIEIIQNL LASAEKVGEQ QFSRASHLLS HCHQCSSIKG  240
TPVQRIVYYF SQALQQKIDQ ETGRRKINGA GKMQSLVLQD TLMNPNPSLL ASYQKVPFSQ  300
VILFTALQVM IENVSEATRI HIIDLEVRNG LHLSMLMEAL AARSDCPLEH LQVTAVGTIS  360
EHKIKETGKR LISVAQSLNL SFSFNVVMVA DMLDHNESHF KLDTKETCAV YAPCILSSMI  420
DRPSRLEHLM TVIQKINPRV MIVTEVEADH NSPVFVNRFI EALFYYSAVF DSMEECMDHS  480
DEDRIISESI NLGSAITNIV VFEGEERKIR HVNSNVWKAF FSQFGMVETE LSRASLYQAK  540
LLVDNFACAS SCTLEMIGKS LSIGWKGTPI LSVSALKFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-3121457527377Protein SCARECROW
5b3h_A1e-3121457526376Protein SCARECROW
5b3h_D1e-3121457526376Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017222255.10.0PREDICTED: scarecrow-like protein 18
TrEMBLA0A175YQ400.0A0A175YQ40_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.15e-46RGA-like 2