PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 493aa    MW: 55673.3 Da    PI: 6.2373
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027004genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.41.5e-801194884374
         GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl....fsevsPilkfshl 96 
                   Ll+ Ae + ++++++  +lL+   +la+pdg+p++Rl++yf+eAL++r+++ +++ l   +  ++ ++++ +++l++l+      ++  P+ ++ ++
  DCAR_027004 119 FLLASAETFVNRQFHQMINLLSMCYQLATPDGNPIKRLVFYFAEALKERIQQeTGNALLGGMGHQRRKTMQLQDALTMLHPaaiaCHQQLPVSQVIQF 216
                  688999999999999999**********************************7788888888888887788777766665455679999********* PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  +  qaIl+ v++++r+H +D++i++Gl W+ ++qaL+ R e p   l+iT+v s   +s+e++e +g+rL++fA+++++pf+fn+ v++++edl  e 
  DCAR_027004 217 ASMQAILDNVSTSSRIHLVDIGIKNGLYWVIFMQALSVRHECPLeLLKITAVIS---SSRESTEVIGKRLSSFAQSINLPFSFNI-VVTSMEDLMEEV 310
                  ***************************************96655499*****99...589999*********************9.7999******** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  ++++++E++a  +++ l ++l+ +  l+     ++ ++k+++P+v+vvve ea +ns+ +++rf+eal  y +lfd+le+ + r s+ r+++E+++l 
  DCAR_027004 311 FSFETEETVAFFSHVYLSTMLAWPNRLAA----LMGVMKKIRPRVMVVVEIEAHTNSPALMDRFIEALFLYGSLFDCLENCMDRCSQFRKTIEAVYLW 404
                  ********************965555555....***************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  + i+n+v+ eg+  ++rhe+   Wr+ ++++G+ +++ls++  +qa+l+l+k + ++  ++  + +sl+ gWk+ p+ svSaW+
  DCAR_027004 405 EGIQNLVTSEGELWIHRHEKIDYWRDVFGRFGLVEMELSKSSLSQADLVLKKNPcGKFCTLAMNGKSLICGWKGAPISSVSAWE 488
                  ******************************************************88889999*********************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.88690467IPR005202Transcription factor GRAS
PfamPF035145.2E-78119488IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MNSIYARTLE QCEEATGESD NVKARTKSLP LASIELLKKC GSKRNHFGFE ENVELNLHVP  60
GNTGNRVLSV EDVMMIAKEK YIQYISHTPD DLSMLFHPLN NHYSGLSGEA AEDIELVVFL  120
LASAETFVNR QFHQMINLLS MCYQLATPDG NPIKRLVFYF AEALKERIQQ ETGNALLGGM  180
GHQRRKTMQL QDALTMLHPA AIACHQQLPV SQVIQFASMQ AILDNVSTSS RIHLVDIGIK  240
NGLYWVIFMQ ALSVRHECPL ELLKITAVIS SSRESTEVIG KRLSSFAQSI NLPFSFNIVV  300
TSMEDLMEEV FSFETEETVA FFSHVYLSTM LAWPNRLAAL MGVMKKIRPR VMVVVEIEAH  360
TNSPALMDRF IEALFLYGSL FDCLENCMDR CSQFRKTIEA VYLWEGIQNL VTSEGELWIH  420
RHEKIDYWRD VFGRFGLVEM ELSKSSLSQA DLVLKKNPCG KFCTLAMNGK SLICGWKGAP  480
ISSVSAWEFR QE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3214648733374GRAS family transcription factor containing protein, expressed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017222110.10.0PREDICTED: DELLA protein RGL3-like
TrEMBLA0A175YPC50.0A0A175YPC5_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.12e-45RGA-like protein 3