PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 469aa    MW: 52215.3 Da    PI: 5.2255
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027003genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS225.62.4e-69964655374
         GRAS   5 LlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.....fsevsPilkfshlt 97 
                  Ll+ A+ v+++++ +a++lL+  ++las +g+p+qRl+ yf++AL+++++r+   +++  +   +++  s ee++++       f  + P   +   +
  DCAR_027003  96 LLASADKVANEQFDRARKLLSMCRHLASCTGSPVQRLVYYFAQALEEKINRKLGIVSSEGRDDCKRWLLSLEEATITLQpplvaFGLAVPSCLVYKSA 193
                  8999***********************************************7777777777776766666666555533566779************* PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                    q Ilea+++++r+H iD+++ +G++Wp L+qaLa R e p  sl iT+++    +s+e+++ tg+rL++fA +lg++f f++  + +++d++ +++
  DCAR_027003 194 GIQSILEAMASATRIHLIDLGLRNGMHWPFLMQALAVRHECPIeSLTITALVT---SSEEMIKDTGKRLSQFAYTLGLNFYFKIARVPDINDIKEDSF 288
                  **************************************966555********9...589*************************8888********** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  ++  gE + V +++ + +++ + ++ e     +++++k+l P v+v++e ea+++s++F++rf+  l +ysalfd+++  l+  + +r+ +E  ++ +
  DCAR_027003 289 EIGAGERIGVYSSMLMRNVVGQLGQFET----LMRVLKNLHPAVMVMIELEAETTSADFMDRFIGGLIHYSALFDAVDLCLGDSNPQRMPMEGYYFCP 382
                  *******************966666666....****************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   i+++v+   +er +   + + Wr+ ++++   + +ls++   qa+l++++ + s   ++  + +sl+  W++ pL+++SaW+
  DCAR_027003 383 GIRQIVTFDVEERAAWDLKIKDWRALFNSFNIVEKELSSSSLYQASLVIKNSSfSSLCTLSMDGKSLLSEWRGTPLFTLSAWE 465
                  *****************************************************8888*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.29366444IPR005202Transcription factor GRAS
PfamPF035148.2E-6796465IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MERTSEASSL ASLELLNTFG CRLKRLRVEQ GNNICYNAVS VPSRKELSTV DIIKVAMDKF  60
LGLSSQSCGD PCMLVHSGYS GLSSEIDDEV EPVLFLLASA DKVANEQFDR ARKLLSMCRH  120
LASCTGSPVQ RLVYYFAQAL EEKINRKLGI VSSEGRDDCK RWLLSLEEAT ITLQPPLVAF  180
GLAVPSCLVY KSAGIQSILE AMASATRIHL IDLGLRNGMH WPFLMQALAV RHECPIESLT  240
ITALVTSSEE MIKDTGKRLS QFAYTLGLNF YFKIARVPDI NDIKEDSFEI GAGERIGVYS  300
SMLMRNVVGQ LGQFETLMRV LKNLHPAVMV MIELEAETTS ADFMDRFIGG LIHYSALFDA  360
VDLCLGDSNP QRMPMEGYYF CPGIRQIVTF DVEERAAWDL KIKDWRALFN SFNIVEKELS  420
SSSLYQASLV IKNSSFSSLC TLSMDGKSLL SEWRGTPLFT LSAWEFLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-32924643374GRAS family transcription factor containing protein, expressed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017221731.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A175YPN30.0A0A175YPN3_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.15e-39RGA-like 1