PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_027002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 565aa    MW: 63522.6 Da    PI: 5.5906
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_027002genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.22.2e-881915622374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl....fsevsPilkfs 94 
                  v  Ll++Ae v +++l++a++lL + se a  dg+p+qRl+ yf+ AL +++ +  + e++k+l+ + +   + +e+++++k     f +  P+ ++s
  DCAR_027002 191 VGNLLAAAEKVGQKKLRRARKLLRKCSEWACDDGNPVQRLVYYFAAALCEKIDQhIGREMSKSLEKKVEL-LDFEEVVMSQKSaniaFLKEVPFAQVS 287
                  5689************************************************996667777777444332.22333333333334459999******* PP

         GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                  ++t  qaI e v++++rvHiiDf i++G   + LlqaLa+R+e p  +lRiT+vg    +s+e+leetg+rL  fAe++++pf+fn++++ ++ dl+ 
  DCAR_027002 288 QFTGVQAIIEHVAEATRVHIIDFFIMNGSNCIVLLQALAARDEHPIeHLRITAVGT---KSQERLEETGKRLMTFAESVNLPFSFNLVMVADMLDLNE 382
                  ******************************************66655*********...68************************************* PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                    ++++ +E+++V++++   +l ++s  le     v++++++++P v+v++e+e +hns+ F++rf+eal yy a+fd++e  + r + +r  vE   
  DCAR_027002 383 GLFKLNAEEVVVVQSSYLFSTLISKSDRLEY----VMRVIRDINPSVMVMIENEGNHNSSVFVKRFVEALFYYGAFFDCIEDCMERSNPDRLLVELIH 476
                  *****************88888866666666....*************************************************************** PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++++i+n+v + g++r+ r+  ++ Wre ++++ + +++ls++    a+l+++k++ +   +++ + ++l++gWk+ p+ s+SaW+
  DCAR_027002 477 FSPAIQNIVVADGEDRITRQVDMSVWREFFKRFMMVELELSKSSLYHARLIVNKFAcGSSCTLDRDGKCLIIGWKGTPIHSLSAWK 562
                  ********************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.299164541IPR005202Transcription factor GRAS
PfamPF035147.6E-86191562IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MSNMPSKLSN SRNIVELYSS SEDLDLDLES EQCGKRKKQI NLNAAGPANS SGFGGFEDLY  60
FDAGSPQVQS CQVQSCQDEI VEVGMVKFED SELGESEKQK AEKFNLDSLG LLKNYGYRFR  120
HLKGEKIEVA GCGVERDKGS ERRVSTDAII RQAGESFINS SVKRCNGFSD ASHTNKLVGL  180
SDKEAKDVEL VGNLLAAAEK VGQKKLRRAR KLLRKCSEWA CDDGNPVQRL VYYFAAALCE  240
KIDQHIGREM SKSLEKKVEL LDFEEVVMSQ KSANIAFLKE VPFAQVSQFT GVQAIIEHVA  300
EATRVHIIDF FIMNGSNCIV LLQALAARDE HPIEHLRITA VGTKSQERLE ETGKRLMTFA  360
ESVNLPFSFN LVMVADMLDL NEGLFKLNAE EVVVVQSSYL FSTLISKSDR LEYVMRVIRD  420
INPSVMVMIE NEGNHNSSVF VKRFVEALFY YGAFFDCIED CMERSNPDRL LVELIHFSPA  480
IQNIVVADGE DRITRQVDMS VWREFFKRFM MVELELSKSS LYHARLIVNK FACGSSCTLD  540
RDGKCLIIGW KGTPIHSLSA WKFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3922056233375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017221732.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLA0A175YPE00.0A0A175YPE0_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_9.721e-164(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-55RGA-like 2