PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BBR-BPC
Protein Properties Length: 288aa    MW: 32204.8 Da    PI: 10.3992
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026825genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind293.86.8e-9012871301
    GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki...rernlalsekkaavaerdmaflqrdkalae.rnkalverdnkllalllvenslasa 94 
                  m+d g ++rn+ +ye++ +   nl+l+l+ s + r + +   re+ + + ++ + + +    f   ++ l+    k  v rd+ + +++ ++      
  DCAR_026825   1 MNDGGLNSRNWNFYEQHYNRPGNLNLHLFPSFERRISGPflgRENAIVMNQNGGQLCP----F-VPESPLHVdPTKDAVARDKFVQQMISANS----- 88 
                  99999999*********88889**********88888878766666644444444433....4.22333333124445555554444444333..... PP

    GAGA_bind  95 lpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekk 192
                  + +g++  + ++s+++lqq    ql++++++ +e  k     + +   ++++ + +kkrq+ + pk +kakk+k+ ++ +k++ ++++  +r+ka +k
  DCAR_026825  89 SFAGYHEHPAAHSMHMLQQ----QLQQPPQQ-HEFPKDVRVAVDT-SVKKEDGAPVKKRQSLAAPKPPKAKKPKRCQTIQKENGTSSG--HRAKAARK 178
                  3567888899999998888....77777666.3333333344444.44455556677799***************7766666666665..79****** PP

    GAGA_bind 193 sidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWA 290
                  ++d+v+ng+++D s++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmSqgafkk+LekLa+e ++++ ++DL+ hWA
  DCAR_026825 179 NMDVVINGINMDFSSIPIPVCSCTGTPQQCYRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASENFNFADAIDLRYHWA 276
                  ************************************************************************************************** PP

    GAGA_bind 291 kHGtnkfvtir 301
                  +HGtnkfvtir
  DCAR_026825 277 RHGTNKFVTIR 287
                  **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.7E-1161287IPR010409GAGA-binding transcriptional activator
PfamPF062171.4E-942287IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MNDGGLNSRN WNFYEQHYNR PGNLNLHLFP SFERRISGPF LGRENAIVMN QNGGQLCPFV  60
PESPLHVDPT KDAVARDKFV QQMISANSSF AGYHEHPAAH SMHMLQQQLQ QPPQQHEFPK  120
DVRVAVDTSV KKEDGAPVKK RQSLAAPKPP KAKKPKRCQT IQKENGTSSG HRAKAARKNM  180
DVVINGINMD FSSIPIPVCS CTGTPQQCYR WGCGGWQSAC CTTTISMYPL PMSTKRRGAR  240
IAGRKMSQGA FKKVLEKLAS ENFNFADAID LRYHWARHGT NKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268137.11e-105GAGA-binding transcriptional activator BBR/BPC1-like
RefseqXP_010650443.11e-105PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
RefseqXP_010650043.11e-105PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
RefseqXP_010649609.11e-105PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
TrEMBLB2Z4541e-105B2Z454_VITVI; GAGA-binding transcriptional activator BBR/BPC1-like
TrEMBLF6HFA41e-104F6HFA4_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g06380.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.22e-74basic pentacysteine1