PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Dof
Protein Properties Length: 366aa    MW: 39906.9 Da    PI: 8.6296
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026660genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.5e-392887362
       zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                  +a++cprCds ntkfCyynnysl+qPr+fCk+C+ryWtkGGalrnvPvGgg+rknkk+s
  DCAR_026660 28 PAAINCPRCDSPNTKFCYYNNYSLTQPRHFCKTCKRYWTKGGALRNVPVGGGCRKNKKTS 87
                 6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-271885IPR003851Zinc finger, Dof-type
PfamPF027011.0E-323085IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0873185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MSSDMNKDER NYQNPSSRGK AMSATRPPAA INCPRCDSPN TKFCYYNNYS LTQPRHFCKT  60
CKRYWTKGGA LRNVPVGGGC RKNKKTSRAS SSRPSSGDFK DSSGASSYSD SGGFRFYNSL  120
QFQLGEGLTN FPRFNNISAP PPVGNQLVSS FGDIPTVPLS SNVMSNFTLE PNPGNNLSQF  180
MALNSFPLSS SSSSSSVLKQ DHADKYGGFK EGLLHDTVPS NSTVPSNSNL AYSIESLSSI  240
NQDLHWKLQQ DRLNTMFNNG GDNSNYPRQN GLISSTANYL EHSQSQKPHP LLFQNLEISS  300
KPADESRMEN TGNVSSANLG TDWCFGNSSY APVVNQNPAI SSGLNIADIK ENQAWANFDQ  360
FTTLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017222418.10.0PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A175YS110.0A0A175YS11_DAUCS; Uncharacterized protein
STRINGXP_009774290.12e-79(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.15e-45Dof family protein