PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family TCP
Protein Properties Length: 331aa    MW: 36871.1 Da    PI: 7.1999
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026267genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.94.3e-39942334133
          TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg............. 88 
                   k rh ki T++g RdRRvRls+++a++fFdLqd LGfdk+s+ti+WLl+q+k ai e+++ ++s+ + + a++ ++  ++ ++g             
  DCAR_026267  94 NKHRHRKIVTAQGSRDRRVRLSIQIARQFFDLQDNLGFDKASQTIDWLLTQSKSAIEEIAKIKQSHCNVA-ANEVEKDIEAAEIGeilkrnssvsiss 190
                  799***********************************************************44444333.222222222222334555555566754 PP

          TCP  89 kaaksaakskksqksaasalnlakesrakarararertrekmrik 133
                   ++ ++  + + +++++  + +ake ra+ar+rarert+ k + +
  DCAR_026267 191 TRSVAKDLGISVEQQHS--SYFAKELRARARERARERTKAKLAVR 233
                  22222224444444444..78*******************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136930.73394152IPR017887Transcription factor TCP subgroup
PfamPF036341.0E-3494229IPR005333Transcription factor, TCP
PROSITE profilePS5137010.696212229IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQSSGITNNE ATFQIPSSFF GNLEDDDFVE QDPGREDHFS FPSGATGNAA DFRLSGDFDH  60
KNNVASEEYV PLVCDPLLIS LLRPRWKKPD VVINKHRHRK IVTAQGSRDR RVRLSIQIAR  120
QFFDLQDNLG FDKASQTIDW LLTQSKSAIE EIAKIKQSHC NVAANEVEKD IEAAEIGEIL  180
KRNSSVSISS TRSVAKDLGI SVEQQHSSYF AKELRARARE RARERTKAKL AVRKLLEVQK  240
LGSDFGCITP NSWNQFSRSS EMSHSIAASI LTTKKVNAVE NLTTYNQQLN VTSSRLVPSS  300
SITITENWEI SNNFSQESPP TAGYGGSVYD *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1214226RARARERARERTK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017217919.10.0PREDICTED: transcription factor CYCLOIDEA-like
TrEMBLA0A161ZNV70.0A0A161ZNV7_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24362359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.28e-25TCP family protein