PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 113aa    MW: 13130.9 Da    PI: 5.3126
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026218genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26026.51.8e-081534597
       DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                 ++k++ +++r + ++sl +eAe r  dP++G  g++++  +q+e+ k+ ++ll
  DCAR_026218  1 MVKNITPDKRLEFIRSLEFEAEYRSVDPINGYKGLVNQNVEQIEEYKKSIKLL 53
                 689999****************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.6E-5152IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508918.938157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
MVKNITPDKR LEFIRSLEFE AEYRSVDPIN GYKGLVNQNV EQIEEYKKSI KLLIEQAKHL  60
RSIEHHREKI AAAEEKIRQL ENIVVTQFQK IGEIYDDENK PEVKEVAGED HA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A161X9935e-74A0A161X993_DAUCS; Uncharacterized protein