PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 522aa    MW: 57930.1 Da    PI: 6.7055
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026212genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3628.7e-1111495201374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfshl 96 
                  lv+lL+ cAeav+ +d + a+ lLa+++  a   g+++qR+a++f+++L  rl+  ++   + l++ +t+  +  s+++  al l +ev+P ++f+h+
  DCAR_026212 149 LVQLLVLCAEAVACRDRSHASVLLAEVRADALVFGTSFQRVASCFVQGLTDRLTFVQPPGTAGLTAAATNIIDiaSEKKEEALDLVYEVCPHIQFGHF 246
                  689****************************************************888888888888887666667888889999************* PP

         GRAS  97 taNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                  +aN  Ilea+ege+ vH++D+++s    +G QW +L+++La+R+++pp  +RiTgvg       e+ + +g  L+ +A++lg+++ef++ v+++ledl
  DCAR_026212 247 VANLSILEAFEGENFVHVVDLGMSlglrHGQQWRNLIRSLANRTGQPPcCVRITGVGL----CVEKFQIIGTELKAYARSLGINLEFSA-VESSLEDL 339
                  ********************98763333788*************988889********....***************************.799***** PP

         GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                  ++e+++++++E+la+n++lqlh +++es    +   ++Lk++ +lsPk++++veq+++hn++ Fl rfleal+yysa+fdsl+a lp+ +  r+k+E+
  DCAR_026212 340 KPEHIKLRKNEVLAINSILQLHCVVKESRGALN---AFLKVIHELSPKILILVEQDSSHNGPFFLGRFLEALHYYSAIFDSLDAMLPKYDTRRAKIEQ 434
                  *************************88887777...9************************************************************* PP

         GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++++ei+n+v+ceg  r+erhe++ +Wr+r+++aGF+p+p   k+ +qak  l k++  +gy++ ee+g+lvlgWk++p+v++S+W+
  DCAR_026212 435 FYFAEEIKNIVSCEGPGRIERHERVDQWRRRMSRAGFQPAPG--KMIAQAKDWLGKHEfCEGYTIVEEKGCLVLGWKSKPIVAASCWK 520
                  ***************************************995..6788***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.793123501IPR005202Transcription factor GRAS
PfamPF035143.0E-108149520IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MAYRFLAHAL YDNEQNVQIN GLDSRSSAMA CYPFPYLHTL NNVASILNPG LSDETSSSKR  60
LKRTTSMGEI LGNTYSSFCS NDSFGSTFSR RSSTSSLNSL PGLHIREHIN AYTQRYLAAE  120
CVEDAASAIV GSDYDGETKE DGVTDEMRLV QLLVLCAEAV ACRDRSHASV LLAEVRADAL  180
VFGTSFQRVA SCFVQGLTDR LTFVQPPGTA GLTAAATNII DIASEKKEEA LDLVYEVCPH  240
IQFGHFVANL SILEAFEGEN FVHVVDLGMS LGLRHGQQWR NLIRSLANRT GQPPCCVRIT  300
GVGLCVEKFQ IIGTELKAYA RSLGINLEFS AVESSLEDLK PEHIKLRKNE VLAINSILQL  360
HCVVKESRGA LNAFLKVIHE LSPKILILVE QDSSHNGPFF LGRFLEALHY YSAIFDSLDA  420
MLPKYDTRRA KIEQFYFAEE IKNIVSCEGP GRIERHERVD QWRRRMSRAG FQPAPGKMIA  480
QAKDWLGKHE FCEGYTIVEE KGCLVLGWKS KPIVAASCWK C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A4e-6315651925377Protein SCARECROW
5b3h_D4e-6315651925377Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017216647.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A164UNM10.0A0A164UNM1_DAUCS; Uncharacterized protein
STRINGXP_009359535.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81672130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-80RGA-like 1