PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 331aa    MW: 36834 Da    PI: 4.6372
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026052genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.95.5e-25138188252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +k ++ e++s yF++pi++AA e++v+lT+LKr+CR +GI+RWPhRk+ sl
  DCAR_026052 138 SKMLTREEISGYFYMPITQAAMEMNVGLTYLKRRCRDLGIRRWPHRKLMSL 188
                  5789********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.587124209IPR003035RWP-RK domain
PfamPF020423.5E-20141188IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAAHSTKAWS DSEAAASAGE DIFTLPSLDC SGFSGYDSST YGIPLPDNND SFSWDDLVPR  60
PSSPVKDEFF CGPLVPRGSG LGEWKDDEMM DIFRGQGQVQ QPLLLCDKSM VVNGEEEQYK  120
ARSCRSAVGK QKGCGSSSKM LTREEISGYF YMPITQAAME MNVGLTYLKR RCRDLGIRRW  180
PHRKLMSLQS LINNVQEIGN REGDAANNEK LKEAIELLEQ EQRRIEAEPD VKLEDKTKRL  240
RQACFKANYK KRKSAINVGQ EDLLMLTDDN SSSRTYSPAD DRSSSSSTGR YIGADFTSDH  300
LTFPGDLNVD DLEMESLFLD SEASPTNTSY *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017219250.10.0PREDICTED: uncharacterized protein LOC108196464
TrEMBLA0A164UJY70.0A0A164UJY7_DAUCS; Uncharacterized protein
STRINGVIT_17s0000g06250.t015e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-50RWP-RK domain-containing protein