PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025784
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 452aa    MW: 51032.5 Da    PI: 6.9526
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025784genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.86.1e-88564442373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfshlta 98 
                  ++lL++cA+a++++d + +q++L+ l+++a +dgd+ +Rl+  f++AL +r ar   +++k +p+ ++ +k   + +++ l  f++++P+++f++ +a
  DCAR_025784  56 EQLLIHCANAIETNDSTSTQQILWVLNNIAPSDGDSSERLTCAFLRALVTRAAR--YGTCKVIPSIPNVQKPiYKFSMMELASFVDLTPWHRFGFTAA 151
                  799***************************************************..777777766666544423444444444*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl.......vakrl 186
                  N aIleave+ + +HiiD++ ++++Q p+L++aLa+R + p  +++T  ++ ++     + +++ +g +L +fA++ ++ +ef+v+         + +
  DCAR_025784 152 NAAILEAVESYSVIHIIDLSSTHCMQIPTLIEALANRVKIPTLVKLTIASATNNIrpiFNISYQDLGTKLVNFARSRNIVLEFKVIsstasngFLSLI 249
                  ***********************************************99987776888999************************9887666555667 PP

         GRAS 187 edleleeL.rvkpgEalaVnlvlqlhrll...........desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                  ++l++++L + k++Eal+Vn++++lh+++           d   s++s r+ +Lk+v sl+P++v +v+++ad++s+s++ r+ +a++y +  +d ++
  DCAR_025784 250 DELKIQQLvHPKRDEALVVNCHMMLHYIPeetlnpqmnflD--SSSASFRTMFLKAVHSLNPTLVLLVDEDADLTSKSLVCRLRSAFNYLWIPYDIID 345
                  8888888834445****************555555544321..22333689*********************************************** PP

         GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                  + lp++s++r+++E+  +g++i+nvva  g++r+er e ++k  er+++a F++v ++e a+++++++l +++  g+ ++ e++ l+l+Wk++++v++
  DCAR_025784 346 TYLPHDSKQRQWYEAD-IGWKIENVVAEDGSRRVERAEAKNKCVERMRNAKFREVGFGEAAVDEVRSMLDEHA-AGWGLKREQEHLMLTWKGHSVVFA 441
                  ****************.********************************************************.999********************* PP

         GRAS 371 SaW 373
                  +aW
  DCAR_025784 442 TAW 444
                  *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.64129426IPR005202Transcription factor GRAS
PfamPF035142.1E-8556444IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MMHFTGTSTP PQMHQIAPFS GFYSSINQVV HSTLPPWPHS IFQPSSRSLR DSYSIEQLLI  60
HCANAIETND STSTQQILWV LNNIAPSDGD SSERLTCAFL RALVTRAARY GTCKVIPSIP  120
NVQKPIYKFS MMELASFVDL TPWHRFGFTA ANAAILEAVE SYSVIHIIDL SSTHCMQIPT  180
LIEALANRVK IPTLVKLTIA SATNNIRPIF NISYQDLGTK LVNFARSRNI VLEFKVISST  240
ASNGFLSLID ELKIQQLVHP KRDEALVVNC HMMLHYIPEE TLNPQMNFLD SSSASFRTMF  300
LKAVHSLNPT LVLLVDEDAD LTSKSLVCRL RSAFNYLWIP YDIIDTYLPH DSKQRQWYEA  360
DIGWKIENVV AEDGSRRVER AEAKNKCVER MRNAKFREVG FGEAAVDEVR SMLDEHAAGW  420
GLKREQEHLM LTWKGHSVVF ATAWIPNSFD Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-465644688474Protein SHORT-ROOT
5b3h_B1e-465644634420Protein SHORT-ROOT
5b3h_E1e-465644634420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017216229.10.0PREDICTED: scarecrow-like protein 32 isoform X1
SwissprotQ9SN221e-163SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A161Y8E20.0A0A161Y8E2_DAUCS; Uncharacterized protein
STRINGEOX916400.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87812429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-165GRAS family protein